Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2337.t1
Gene name
Locationscaffold_02:2301236..2302055
Strand-
Gene length (bp)819
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 163 185 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.40 0.00 1.05
5d_25C Five days - 25 degrees Celsius 0.00 0.00 0.00
7d_25C Seven days - 25 degrees Celsius 0.00 0.00 0.00
10d_25C Ten days - 25 degrees Celsius 0.04 0.00 0.23
7d_15C Seven days - 15 degrees Celsius 0.00 0.00 0.00
7d_30C Seven days - 30 degrees Celsius 4.97 0.75 9.19

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 1.000000 no
3d_25C 7d_25C 1.000000 no
3d_25C 7d_15C 1.000000 no
3d_25C 7d_30C 0.014971 yes
3d_25C 10d_25C 1.000000 no
5d_25C 7d_25C 1.000000 no
5d_25C 7d_15C 1.000000 no
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 1.000000 no
7d_25C 7d_15C 1.000000 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 1.000000 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 1.000000 no
7d_30C 10d_25C 0.356374 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2337.t1
MIPLYALFLIPLVNGWTFRYTNATNATEIARGQDSQNCTNSPIGKEKLFTWDPEGSGLCVSIYRDLKCDSRAGYA
CEIWRKNASEAFAAFDVLPETEIDAKHQTSTLAVSTSTSATTSASASISTPSSVSSELVSAIPTGSTAVSTANSD
SGFSDSSLSGGAIAGIVVGVVAAVAIIVAFVVILIRKRNKKNTAVANQHGGYEPHEADATGSSISGTTAVVEKAA
DSAVRPFRPPPGSKIIELVGDEGSAELGSSPISEMDGNNIKKGFNRF*
Coding >Pro_DTO377G3_2|g2337.t1
ATGATACCATTATATGCACTTTTCCTAATTCCCCTGGTGAATGGATGGACCTTCCGCTACACCAACGCGACCAAT
GCCACTGAAATAGCCCGCGGCCAAGATTCACAGAACTGCACAAATTCCCCTATTGGTAAAGAAAAGCTTTTTACC
TGGGATCCCGAGGGATCTGGCCTATGTGTCTCGATATACCGCGACCTCAAGTGTGACTCCAGGGCGGGATATGCA
TGCGAAATATGGAGAAAGAATGCCAGTGAAGCATTTGCGGCTTTTGATGTCCTGCCTGAGACGGAGATTGATGCC
AAACACCAAACATCTACACTCGCGGTATCGACGTCTACATCCGCTACGACATCCGCATCTGCATCCATATCCACA
CCTTCATCTGTGTCTTCAGAATTGGTATCCGCAATCCCCACCGGGTCCACCGCAGTGTCTACAGCCAATTCTGAC
AGCGGCTTCTCTGATTCATCGCTCTCCGGTGGTGCTATTGCAGGCATCGTGGTTGGCGTCGTAGCTGCGGTTGCT
ATTATAGTCGCTTTCGTTGTCATTCTCATCAGAAAAAGGAACAAAAAGAACACCGCGGTTGCCAACCAGCATGGT
GGTTATGAGCCCCATGAGGCGGATGCTACTGGATCATCGATAAGTGGTACTACCGCGGTTGTGGAGAAAGCAGCA
GACTCGGCCGTGCGCCCATTCAGGCCTCCCCCTGGGTCCAAGATTATTGAGTTGGTTGGAGATGAAGGAAGTGCT
GAACTGGGCAGCAGCCCCATAAGTGAGATGGATGGAAACAATATCAAGAAAGGTTTCAACCGGTTCTAA
Transcript >Pro_DTO377G3_2|g2337.t1
ATGATACCATTATATGCACTTTTCCTAATTCCCCTGGTGAATGGATGGACCTTCCGCTACACCAACGCGACCAAT
GCCACTGAAATAGCCCGCGGCCAAGATTCACAGAACTGCACAAATTCCCCTATTGGTAAAGAAAAGCTTTTTACC
TGGGATCCCGAGGGATCTGGCCTATGTGTCTCGATATACCGCGACCTCAAGTGTGACTCCAGGGCGGGATATGCA
TGCGAAATATGGAGAAAGAATGCCAGTGAAGCATTTGCGGCTTTTGATGTCCTGCCTGAGACGGAGATTGATGCC
AAACACCAAACATCTACACTCGCGGTATCGACGTCTACATCCGCTACGACATCCGCATCTGCATCCATATCCACA
CCTTCATCTGTGTCTTCAGAATTGGTATCCGCAATCCCCACCGGGTCCACCGCAGTGTCTACAGCCAATTCTGAC
AGCGGCTTCTCTGATTCATCGCTCTCCGGTGGTGCTATTGCAGGCATCGTGGTTGGCGTCGTAGCTGCGGTTGCT
ATTATAGTCGCTTTCGTTGTCATTCTCATCAGAAAAAGGAACAAAAAGAACACCGCGGTTGCCAACCAGCATGGT
GGTTATGAGCCCCATGAGGCGGATGCTACTGGATCATCGATAAGTGGTACTACCGCGGTTGTGGAGAAAGCAGCA
GACTCGGCCGTGCGCCCATTCAGGCCTCCCCCTGGGTCCAAGATTATTGAGTTGGTTGGAGATGAAGGAAGTGCT
GAACTGGGCAGCAGCCCCATAAGTGAGATGGATGGAAACAATATCAAGAAAGGTTTCAACCGGTTCTAA
Gene >Pro_DTO377G3_2|g2337.t1
ATGATACCATTATATGCACTTTTCCTAATTCCCCTGGTGAATGGATGGACCTTCCGCTACACCAACGCGACCAAT
GCCACTGAAATAGCCCGCGGCCAAGATTCACAGAACTGCACAAATTCCCCTATTGGTAAAGAAAAGCTTTTTACC
TGGGATCCCGAGGGATCTGGCCTATGTGTCTCGATATACCGCGACCTCAAGTGTGACTCCAGGGCGGGATATGCA
TGCGAAATATGGAGAAAGAATGCCAGTGAAGCATTTGCGGCTTTTGATGTCCTGCCTGAGACGGAGATTGATGCC
AAACACCAAACATCTACACTCGCGGTATCGACGTCTACATCCGCTACGACATCCGCATCTGCATCCATATCCACA
CCTTCATCTGTGTCTTCAGAATTGGTATCCGCAATCCCCACCGGGTCCACCGCAGTGTCTACAGCCAATTCTGAC
AGCGGCTTCTCTGATTCATCGCTCTCCGGTGGTGCTATTGCAGGCATCGTGGTTGGCGTCGTAGCTGCGGTTGCT
ATTATAGTCGCTTTCGTTGTCATTCTCATCAGAAAAAGGAACAAAAAGAACACCGCGGTTGCCAACCAGCATGGT
GGTTATGAGCCCCATGAGGCGGATGCTACTGGATCATCGATAAGTGGTACTACCGCGGTTGTGGAGAAAGCAGCA
GACTCGGCCGTGCGCCCATTCAGGCCTCCCCCTGGGTCCAAGATTATTGAGTTGGTTGGAGATGAAGGAAGTGCT
GAACTGGGCAGCAGCCCCATAAGTGAGATGGATGGAAACAATATCAAGAAAGGTTTCAACCGGTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail