Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2285.t1
Gene name
Locationscaffold_02:2146139..2147318
Strand-
Gene length (bp)1179
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01634 HisG ATP phosphoribosyltransferase 3.3E-54 58 225
PF08029 HisG_C HisG, C-terminal domain 3.9E-28 229 301

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0000287 magnesium ion binding Yes
GO:0003879 ATP phosphoribosyltransferase activity Yes
GO:0000105 histidine biosynthetic process Yes
GO:0071704 organic substance metabolic process No
GO:0006547 histidine metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0005575 cellular_component No
GO:0006082 organic acid metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0008150 biological_process No
GO:0016757 glycosyltransferase activity No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043167 ion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No
GO:0044283 small molecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043169 cation binding No
GO:0016763 pentosyltransferase activity No
GO:0044238 primary metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0003674 molecular_function No
GO:0008652 cellular amino acid biosynthetic process No
GO:0009058 biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 67.15 38.75 95.56
5d_25C Five days - 25 degrees Celsius 48.62 26.30 70.94
7d_25C Seven days - 25 degrees Celsius 43.47 22.95 63.98
10d_25C Ten days - 25 degrees Celsius 24.84 11.43 38.26
7d_15C Seven days - 15 degrees Celsius 69.01 39.87 98.14
7d_30C Seven days - 30 degrees Celsius 36.29 18.41 54.18

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.202625 no
3d_25C 7d_25C 0.071362 no
3d_25C 7d_15C 0.940557 no
3d_25C 7d_30C 0.008469 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.752508 no
5d_25C 7d_15C 0.159868 no
5d_25C 7d_30C 0.312471 no
5d_25C 10d_25C 0.011388 yes
7d_25C 7d_15C 0.055667 no
7d_25C 7d_30C 0.573498 no
7d_25C 10d_25C 0.039770 yes
7d_15C 7d_30C 0.006742 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.198288 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2285.t1
MDLVNHLEGRLLFAVPKKGRLQQATLDLLAGCDVQFRRETRLDIALVKNLPIALIFLPAADIPTFVGEGRVDLGI
TGRDQVAEHDATLPTGEASNVEEILDLGFGACKLQVQVPEKGDIKEAKDLVGRNVVTSFTALTESFFRNLEGAEV
GQKLSTNIKYVGGSVEAACALGVADGIVDLVESGETMKAAGLKAIDTVVSSTAVLVKSRKTNSEMLTILSSRLRG
VITAQKFVLCQYNIPREQLAIASKITPGKRAPTITALEEEGWVAVSSMVEKKHIATVMDELIKVGASDILVMNIA
NSRTD*
Coding >Pro_DTO377G3_2|g2285.t1
ATGGATCTCGTCAACCACCTCGAAGGCCGTCTCCTCTTCGCCGTGCCCAAAAAAGGACGTCTGCAACAAGCAACC
CTCGACCTCCTCGCCGGCTGTGACGTCCAGTTCCGCCGCGAAACCCGCCTCGATATCGCACTGGTCAAGAATTTG
CCCATTGCGCTGATCTTCCTGCCCGCTGCCGATATCCCGACATTCGTCGGCGAAGGCCGCGTTGATTTGGGAATC
ACCGGCCGCGACCAGGTCGCCGAGCACGATGCCACCCTGCCCACCGGCGAGGCCTCCAACGTCGAGGAGATCCTC
GACCTGGGCTTCGGCGCCTGCAAGCTGCAAGTGCAGGTGCCTGAGAAGGGCGATATCAAAGAGGCCAAGGATCTC
GTTGGCCGCAACGTCGTGACCAGCTTCACTGCCCTCACTGAATCTTTCTTCCGTAACCTCGAGGGCGCCGAAGTT
GGCCAGAAACTCTCCACGAATATCAAGTATGTTGGCGGTAGTGTTGAGGCTGCCTGCGCTCTCGGCGTTGCGGAT
GGTATTGTTGATCTTGTTGAGTCTGGTGAGACTATGAAGGCCGCTGGCCTGAAGGCAATTGACACTGTTGTCTCC
AGCACCGCTGTGCTGGTCAAGTCCCGCAAGACCAACTCCGAAATGCTCACTATACTCAGCTCCCGTCTGCGTGGT
GTCATCACCGCCCAGAAGTTCGTCCTGTGCCAATACAACATCCCGCGTGAGCAGCTGGCAATCGCGTCCAAGATC
ACCCCCGGCAAGCGTGCGCCTACTATCACCGCGCTCGAGGAGGAGGGCTGGGTTGCTGTCAGCTCCATGGTGGAG
AAGAAGCACATTGCCACGGTAATGGATGAGCTGATTAAGGTCGGCGCGAGTGATATCTTGGTCATGAACATTGCC
AACTCGCGCACGGATTAA
Transcript >Pro_DTO377G3_2|g2285.t1
ATGGATCTCGTCAACCACCTCGAAGGCCGTCTCCTCTTCGCCGTGCCCAAAAAAGGACGTCTGCAACAAGCAACC
CTCGACCTCCTCGCCGGCTGTGACGTCCAGTTCCGCCGCGAAACCCGCCTCGATATCGCACTGGTCAAGAATTTG
CCCATTGCGCTGATCTTCCTGCCCGCTGCCGATATCCCGACATTCGTCGGCGAAGGCCGCGTTGATTTGGGAATC
ACCGGCCGCGACCAGGTCGCCGAGCACGATGCCACCCTGCCCACCGGCGAGGCCTCCAACGTCGAGGAGATCCTC
GACCTGGGCTTCGGCGCCTGCAAGCTGCAAGTGCAGGTGCCTGAGAAGGGCGATATCAAAGAGGCCAAGGATCTC
GTTGGCCGCAACGTCGTGACCAGCTTCACTGCCCTCACTGAATCTTTCTTCCGTAACCTCGAGGGCGCCGAAGTT
GGCCAGAAACTCTCCACGAATATCAAGTATGTTGGCGGTAGTGTTGAGGCTGCCTGCGCTCTCGGCGTTGCGGAT
GGTATTGTTGATCTTGTTGAGTCTGGTGAGACTATGAAGGCCGCTGGCCTGAAGGCAATTGACACTGTTGTCTCC
AGCACCGCTGTGCTGGTCAAGTCCCGCAAGACCAACTCCGAAATGCTCACTATACTCAGCTCCCGTCTGCGTGGT
GTCATCACCGCCCAGAAGTTCGTCCTGTGCCAATACAACATCCCGCGTGAGCAGCTGGCAATCGCGTCCAAGATC
ACCCCCGGCAAGCGTGCGCCTACTATCACCGCGCTCGAGGAGGAGGGCTGGGTTGCTGTCAGCTCCATGGTGGAG
AAGAAGCACATTGCCACGGTAATGGATGAGCTGATTAAGGTCGGCGCGAGTGATATCTTGGTCATGAACATTGCC
AACTCGCGCACGGATTAA
Gene >Pro_DTO377G3_2|g2285.t1
ATGGATCTCGTCAACCAGTGAGTCAATTTCAATTACAAACCGCATGGGGATTTCTGCTAATATAACGATTCTAAA
CAGCCTCGAAGGCCGTCTCCTCTTCGCCGTGCCCAAAAGCAAGTGCTCTCCCAAATCGTGACTCATAGATGCGAG
CAGCGATACCCACATGAACAAGAAACAAACACAAAGAAACCAAGACTGACGGCGCAAACTCCACTATACAGAAGG
ACGTCTGCAACAAGCAACCCTCGACCTCCTCGCCGGCTGTGACGTCCAGTTCCGCCGCGAAACCCGCCTCGATAT
CGCACTGGTCAAGAATTTGCCCATTGCGCTGATCTTCCTGCCCGCTGCCGATATCCCGACATTCGTCGGCGAAGG
CCGCGTTGATTTGGGAATCACCGGCCGCGACCAGGTCGCCGAGCACGATGCCACCCTGCCCACCGGCGAGGCCTC
CAACGTCGAGGAGATCCTCGACCTGGGCTTCGGCGCCTGCAAGCTGCAAGTGCAGGTGCCTGAGAAGGGCGATAT
CAAAGAGGCCAAGGATCTCGTTGGCCGCAACGTCGTGACCAGCTTCACTGCCCTCACTGAATCTTTCTTCCGTAA
CCTCGAGGGCGCCGAAGTTGGCCAGAAACTCTCCACGAATATCAAGTATGTTGGCGGTAGTGTTGAGGCTGCCTG
CGCTCTCGGCGTTGCGGATGGTATTGTTGATCTTGTTGGTATGTTGTGATATGCCAGTCTACTGAAATACTGTCC
TGTGGAATACGGAACAGGGAACCGGAACCCGTTGCTAACACTCAAATCTGTTCAGAGTCTGGTGAGACTATGAAG
GCCGCTGGCCTGAAGGCAATTGACACTGTTGTCTCCAGCACCGCTGTGCTGGTCAAGTCCCGCAAGACCAACTCC
GAAATGCTCACTATACTCAGCTCCCGTCTGCGTGGTGTCATCACCGCCCAGAAGTTCGTCCTGTGCCAATACAAC
ATCCCGCGTGAGCAGCTGGCAATCGCGTCCAAGATCACCCCCGGCAAGCGTGCGCCTACTATCACCGCGCTCGAG
GAGGAGGGCTGGGTTGCTGTCAGCTCCATGGTGGAGAAGAAGCACATTGCCACGGTAATGGATGAGCTGATTAAG
GTCGGCGCGAGTGATATCTTGGTCATGAACATTGCCAACTCGCGCACGGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail