Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2279.t1
Gene name
Locationscaffold_02:2130879..2134854
Strand+
Gene length (bp)3975
Transcript length (bp)3690
Coding sequence length (bp)3690
Protein length (aa) 1230

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain 5.6E-49 537 677
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 4.5E-09 921 1004

GO

GO Term Description Terminal node
GO:0003964 RNA-directed DNA polymerase activity Yes
GO:0140097 catalytic activity, acting on DNA No
GO:0034061 DNA polymerase activity No
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016779 nucleotidyltransferase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2279.t1
MGKKRKRPIKDRGSTSSSHTGITTSPRRFRPPHAPIPLGTKTSHPVISLYYRNVVPLREYLLHKLPVTSKSRRRR
ILTLGSREDQGTNAQLQTSETLAELLDSTLVGVLKESSPTLNYERQKQYSSFNESQSRSILVSTDTGPTCPQSEV
VDFVIWKIFNRSNGYSKEAKHLLTHGFKRMSMHHAQHTGIPGIVSQFPNQNVQVLKKGAWAEVLGLLGSNGEEIM
MQLLFDCGVFAPIDAENGIYYQLSGIPLSDLEPLSDASAEANGSTATAQDSMPTAGQRHPKEKAEYKQSSEMLQS
PNNIVFMRRRILYGRVESKKGVASGLGQKHVLGRFSTLDSMAQTVHVMKYIFPRQFGLLNVFTLDSDQRKQMNDS
NGFMSRESEISLLEEQKRPQGPQTGSESADAGCGGVKSVKVPKRLRGITIELVRKLRNRNAQCSYGELLRYYCPT
EQTEPRLLGASVSTTDAKKSEPISSLESNFVTQVNYPSPSDSSQTSCDGARSEPHIAVDTSCGNDAEKPVIRKTQ
VSLTDHATPPSSVSAFCRAVIQKLIPRQFWGVGPDGISNFKLVLRHVDRFIKLRRFESLSLHEVCKGVKITSIPW
LAPPQVQTSLPSETRSKIALSDLHKRTELLHEFMFWIFDSLLIPLIRSHFYVTESQVHRNRLFYFRHDVWQQLTQ
QPFGDLKAMMFEELESDQAQRVLARRSFGFGALRLLPKSTGIRPILNLRKRDLKTRSWGKRETYLGISINSSITP
IYNMLTYEREQAPAKLGSSILSVADMHRRLKAYKEQLSQRLPSASRPWQSKLPPMYFVKVDIKACFDTIPQKKLL
NLIEELVSEESYCIAKHTEIHPPTSTAKQGKPIRRFLSRATPAMKPQHLPDYVNSESTTRKANTVFVECGQKEND
ADSLLELLSEHVQNNLVKIGKRFFRQRNGIPQGSVLSSLLCNFFYAELERKVLNFIKPEDSLLLRLVDDFLLVTP
DVAVAMQFLEVMIRGQPSYGVQVNPAKSMANFSAAVDGILLPRLEGSTLFPYCGSLIDTHTLEFHRDQDRILQGG
ESAAATLSDALTVEAARLPGRTFHRKMLSSFRLQLYSMYIDDGHNSRAVVLANLYCSFITAAMRMYRYMKSLRGR
AHPGPAIITQTIRDLIRQTNRYIQARRAGNSESPFSCFVQRSHLQYLASAAFRFVLKRKQTRYAVVLRWLDSLSK
DSRPTSDSEASRIAQVVKKGNAMFEEWRF*
Coding >Pro_DTO377G3_2|g2279.t1
ATGGGCAAAAAGAGGAAAAGACCCATCAAGGACCGCGGGTCCACGTCCTCGTCTCACACGGGTATCACCACGTCT
CCCCGCCGTTTCAGGCCTCCCCATGCGCCAATTCCCCTGGGAACAAAAACAAGCCATCCCGTTATCTCGCTGTAC
TACCGAAATGTCGTACCCTTGCGGGAGTACCTGCTCCATAAACTTCCCGTGACCTCCAAGTCGCGTCGGCGCCGC
ATCCTGACATTGGGCTCGCGGGAAGACCAAGGGACCAATGCACAACTTCAAACGTCTGAGACATTGGCGGAGCTG
CTAGACTCCACACTGGTGGGTGTGCTGAAGGAATCGTCTCCGACCCTTAATTACGAACGACAAAAGCAATACTCC
TCTTTTAATGAGTCTCAATCGCGGTCAATTCTCGTCAGCACCGATACCGGGCCGACTTGTCCCCAATCGGAGGTG
GTTGACTTTGTGATCTGGAAAATCTTCAATCGTAGCAATGGCTACTCTAAAGAGGCCAAGCATCTGCTGACGCAT
GGCTTCAAACGCATGTCTATGCACCATGCTCAACACACTGGTATTCCAGGCATCGTGTCTCAGTTTCCGAATCAG
AATGTTCAGGTTCTCAAGAAGGGTGCATGGGCAGAGGTCCTGGGCTTGCTTGGTAGTAATGGGGAGGAGATTATG
ATGCAGCTCCTTTTTGATTGCGGAGTTTTTGCCCCGATCGACGCTGAAAATGGCATCTACTACCAACTTAGCGGT
ATCCCACTCTCGGATCTCGAGCCTTTGAGCGACGCATCTGCGGAAGCCAACGGCTCTACTGCCACAGCACAAGAC
TCAATGCCTACCGCTGGTCAAAGACATCCCAAAGAGAAAGCTGAATACAAACAGAGTTCCGAGATGCTCCAAAGC
CCAAACAACATTGTGTTTATGCGGCGACGTATCCTCTATGGGCGTGTCGAGTCTAAAAAGGGAGTAGCCTCTGGA
CTAGGACAGAAACATGTTCTTGGCCGCTTCTCAACGCTTGATTCGATGGCGCAAACAGTCCATGTTATGAAGTAC
ATATTTCCCCGTCAATTCGGCCTGCTGAATGTATTTACGCTGGACTCGGATCAACGCAAGCAGATGAATGACTCG
AATGGTTTCATGTCTCGTGAGAGTGAGATATCTCTTTTGGAAGAACAGAAACGACCACAGGGGCCTCAGACTGGG
AGTGAATCAGCAGATGCAGGTTGTGGTGGCGTGAAAAGTGTCAAGGTACCTAAGAGGCTTCGTGGAATTACTATA
GAGCTTGTCCGGAAGCTCCGGAACCGCAACGCACAATGCTCCTACGGAGAGTTGCTGCGATACTATTGTCCAACC
GAACAAACCGAACCCAGACTCCTTGGCGCATCTGTCTCCACAACTGATGCTAAAAAAAGCGAGCCTATCTCCTCT
CTCGAGTCAAATTTTGTAACACAGGTGAACTACCCGTCGCCAAGTGATAGTTCGCAGACCTCATGTGATGGCGCG
AGATCAGAGCCGCACATAGCTGTCGACACATCTTGTGGAAACGATGCCGAGAAACCGGTGATCCGAAAGACTCAA
GTCAGTCTAACTGATCATGCGACTCCGCCATCTTCTGTCTCGGCATTTTGTCGAGCGGTAATCCAGAAATTGATC
CCACGGCAGTTTTGGGGGGTTGGTCCAGATGGTATTTCGAACTTCAAGCTGGTTCTCAGGCATGTTGACCGATTT
ATCAAATTGCGCCGATTCGAAAGTCTAAGTCTGCACGAAGTCTGCAAAGGTGTCAAGATAACAAGCATTCCTTGG
CTGGCGCCACCCCAGGTCCAGACTAGTCTGCCATCTGAGACAAGATCGAAGATCGCCCTGTCTGACTTGCACAAA
CGCACCGAGCTACTCCATGAATTCATGTTTTGGATTTTCGATTCACTCCTTATTCCTCTCATTCGTTCGCATTTC
TATGTCACCGAGTCTCAAGTGCACCGAAACCGCCTTTTCTATTTCCGCCATGATGTGTGGCAGCAGTTGACCCAG
CAACCTTTCGGTGACTTGAAGGCAATGATGTTCGAGGAGCTTGAGTCAGATCAAGCCCAACGTGTGCTGGCGCGG
CGGTCCTTTGGTTTCGGTGCTCTCCGTTTGCTTCCCAAGTCTACAGGCATCCGGCCCATCTTGAACCTTCGCAAA
CGAGATTTGAAGACACGGTCATGGGGGAAACGGGAAACGTACCTTGGCATCAGCATCAATTCAAGTATTACGCCT
ATTTATAACATGTTGACCTATGAGCGTGAGCAAGCTCCTGCCAAATTGGGCTCGTCGATACTCTCCGTTGCAGAT
ATGCACCGCCGATTGAAGGCGTACAAAGAACAATTGTCCCAACGACTGCCCTCGGCTTCTAGACCTTGGCAATCC
AAGCTCCCACCGATGTACTTTGTCAAGGTTGATATCAAAGCTTGTTTTGATACTATCCCCCAGAAAAAGCTGCTT
AATCTTATCGAAGAGCTGGTCTCTGAAGAGAGCTACTGCATCGCAAAGCACACCGAGATCCACCCGCCCACTTCT
ACTGCGAAACAAGGAAAGCCCATACGAAGGTTTCTGAGTCGCGCTACTCCTGCTATGAAACCGCAACACCTACCA
GACTACGTCAATAGCGAAAGCACGACCCGAAAGGCCAACACCGTTTTTGTTGAGTGTGGTCAAAAAGAAAATGAT
GCTGATAGTCTTCTGGAACTTCTCAGTGAACATGTCCAGAACAACCTCGTGAAGATAGGCAAGAGATTTTTCCGC
CAACGCAACGGCATTCCTCAAGGCTCCGTGCTATCAAGCCTCCTTTGCAATTTCTTCTATGCCGAGCTTGAGCGA
AAGGTACTGAATTTCATCAAACCCGAGGATTCTCTTCTCCTGCGACTCGTGGACGATTTCCTTCTGGTCACCCCG
GATGTAGCTGTGGCAATGCAGTTTCTGGAAGTAATGATCAGGGGCCAACCATCGTACGGTGTACAGGTCAATCCA
GCGAAAAGCATGGCCAATTTCAGCGCAGCGGTTGACGGGATTTTACTTCCCAGATTAGAGGGAAGCACATTATTT
CCGTATTGCGGTAGTCTCATCGACACTCACACGCTGGAATTTCACCGCGATCAAGACCGCATCCTTCAGGGCGGC
GAGTCGGCTGCTGCTACTCTCTCCGATGCCTTGACCGTTGAAGCCGCCCGCCTACCCGGCCGTACCTTTCACCGC
AAAATGCTCTCCTCATTCCGTCTGCAGCTATATTCCATGTACATTGATGACGGACACAATTCGCGCGCAGTTGTG
CTAGCCAACCTCTACTGCAGCTTCATCACTGCTGCCATGAGGATGTACCGCTATATGAAGTCGCTTCGGGGTCGT
GCGCATCCCGGCCCTGCCATCATAACACAGACTATCCGCGATCTGATTCGGCAGACGAACCGTTATATCCAGGCC
CGGCGTGCTGGTAATTCGGAGTCCCCATTCTCGTGTTTCGTTCAGCGATCCCATTTACAGTATCTGGCTTCTGCG
GCATTTCGGTTTGTTTTGAAGCGCAAGCAAACACGGTATGCGGTGGTGCTGCGCTGGCTAGACTCGCTGAGTAAA
GATTCTCGACCCACATCAGATTCCGAGGCTTCGAGAATAGCACAGGTAGTGAAGAAGGGAAATGCCATGTTCGAG
GAATGGCGGTTCTAG
Transcript >Pro_DTO377G3_2|g2279.t1
ATGGGCAAAAAGAGGAAAAGACCCATCAAGGACCGCGGGTCCACGTCCTCGTCTCACACGGGTATCACCACGTCT
CCCCGCCGTTTCAGGCCTCCCCATGCGCCAATTCCCCTGGGAACAAAAACAAGCCATCCCGTTATCTCGCTGTAC
TACCGAAATGTCGTACCCTTGCGGGAGTACCTGCTCCATAAACTTCCCGTGACCTCCAAGTCGCGTCGGCGCCGC
ATCCTGACATTGGGCTCGCGGGAAGACCAAGGGACCAATGCACAACTTCAAACGTCTGAGACATTGGCGGAGCTG
CTAGACTCCACACTGGTGGGTGTGCTGAAGGAATCGTCTCCGACCCTTAATTACGAACGACAAAAGCAATACTCC
TCTTTTAATGAGTCTCAATCGCGGTCAATTCTCGTCAGCACCGATACCGGGCCGACTTGTCCCCAATCGGAGGTG
GTTGACTTTGTGATCTGGAAAATCTTCAATCGTAGCAATGGCTACTCTAAAGAGGCCAAGCATCTGCTGACGCAT
GGCTTCAAACGCATGTCTATGCACCATGCTCAACACACTGGTATTCCAGGCATCGTGTCTCAGTTTCCGAATCAG
AATGTTCAGGTTCTCAAGAAGGGTGCATGGGCAGAGGTCCTGGGCTTGCTTGGTAGTAATGGGGAGGAGATTATG
ATGCAGCTCCTTTTTGATTGCGGAGTTTTTGCCCCGATCGACGCTGAAAATGGCATCTACTACCAACTTAGCGGT
ATCCCACTCTCGGATCTCGAGCCTTTGAGCGACGCATCTGCGGAAGCCAACGGCTCTACTGCCACAGCACAAGAC
TCAATGCCTACCGCTGGTCAAAGACATCCCAAAGAGAAAGCTGAATACAAACAGAGTTCCGAGATGCTCCAAAGC
CCAAACAACATTGTGTTTATGCGGCGACGTATCCTCTATGGGCGTGTCGAGTCTAAAAAGGGAGTAGCCTCTGGA
CTAGGACAGAAACATGTTCTTGGCCGCTTCTCAACGCTTGATTCGATGGCGCAAACAGTCCATGTTATGAAGTAC
ATATTTCCCCGTCAATTCGGCCTGCTGAATGTATTTACGCTGGACTCGGATCAACGCAAGCAGATGAATGACTCG
AATGGTTTCATGTCTCGTGAGAGTGAGATATCTCTTTTGGAAGAACAGAAACGACCACAGGGGCCTCAGACTGGG
AGTGAATCAGCAGATGCAGGTTGTGGTGGCGTGAAAAGTGTCAAGGTACCTAAGAGGCTTCGTGGAATTACTATA
GAGCTTGTCCGGAAGCTCCGGAACCGCAACGCACAATGCTCCTACGGAGAGTTGCTGCGATACTATTGTCCAACC
GAACAAACCGAACCCAGACTCCTTGGCGCATCTGTCTCCACAACTGATGCTAAAAAAAGCGAGCCTATCTCCTCT
CTCGAGTCAAATTTTGTAACACAGGTGAACTACCCGTCGCCAAGTGATAGTTCGCAGACCTCATGTGATGGCGCG
AGATCAGAGCCGCACATAGCTGTCGACACATCTTGTGGAAACGATGCCGAGAAACCGGTGATCCGAAAGACTCAA
GTCAGTCTAACTGATCATGCGACTCCGCCATCTTCTGTCTCGGCATTTTGTCGAGCGGTAATCCAGAAATTGATC
CCACGGCAGTTTTGGGGGGTTGGTCCAGATGGTATTTCGAACTTCAAGCTGGTTCTCAGGCATGTTGACCGATTT
ATCAAATTGCGCCGATTCGAAAGTCTAAGTCTGCACGAAGTCTGCAAAGGTGTCAAGATAACAAGCATTCCTTGG
CTGGCGCCACCCCAGGTCCAGACTAGTCTGCCATCTGAGACAAGATCGAAGATCGCCCTGTCTGACTTGCACAAA
CGCACCGAGCTACTCCATGAATTCATGTTTTGGATTTTCGATTCACTCCTTATTCCTCTCATTCGTTCGCATTTC
TATGTCACCGAGTCTCAAGTGCACCGAAACCGCCTTTTCTATTTCCGCCATGATGTGTGGCAGCAGTTGACCCAG
CAACCTTTCGGTGACTTGAAGGCAATGATGTTCGAGGAGCTTGAGTCAGATCAAGCCCAACGTGTGCTGGCGCGG
CGGTCCTTTGGTTTCGGTGCTCTCCGTTTGCTTCCCAAGTCTACAGGCATCCGGCCCATCTTGAACCTTCGCAAA
CGAGATTTGAAGACACGGTCATGGGGGAAACGGGAAACGTACCTTGGCATCAGCATCAATTCAAGTATTACGCCT
ATTTATAACATGTTGACCTATGAGCGTGAGCAAGCTCCTGCCAAATTGGGCTCGTCGATACTCTCCGTTGCAGAT
ATGCACCGCCGATTGAAGGCGTACAAAGAACAATTGTCCCAACGACTGCCCTCGGCTTCTAGACCTTGGCAATCC
AAGCTCCCACCGATGTACTTTGTCAAGGTTGATATCAAAGCTTGTTTTGATACTATCCCCCAGAAAAAGCTGCTT
AATCTTATCGAAGAGCTGGTCTCTGAAGAGAGCTACTGCATCGCAAAGCACACCGAGATCCACCCGCCCACTTCT
ACTGCGAAACAAGGAAAGCCCATACGAAGGTTTCTGAGTCGCGCTACTCCTGCTATGAAACCGCAACACCTACCA
GACTACGTCAATAGCGAAAGCACGACCCGAAAGGCCAACACCGTTTTTGTTGAGTGTGGTCAAAAAGAAAATGAT
GCTGATAGTCTTCTGGAACTTCTCAGTGAACATGTCCAGAACAACCTCGTGAAGATAGGCAAGAGATTTTTCCGC
CAACGCAACGGCATTCCTCAAGGCTCCGTGCTATCAAGCCTCCTTTGCAATTTCTTCTATGCCGAGCTTGAGCGA
AAGGTACTGAATTTCATCAAACCCGAGGATTCTCTTCTCCTGCGACTCGTGGACGATTTCCTTCTGGTCACCCCG
GATGTAGCTGTGGCAATGCAGTTTCTGGAAGTAATGATCAGGGGCCAACCATCGTACGGTGTACAGGTCAATCCA
GCGAAAAGCATGGCCAATTTCAGCGCAGCGGTTGACGGGATTTTACTTCCCAGATTAGAGGGAAGCACATTATTT
CCGTATTGCGGTAGTCTCATCGACACTCACACGCTGGAATTTCACCGCGATCAAGACCGCATCCTTCAGGGCGGC
GAGTCGGCTGCTGCTACTCTCTCCGATGCCTTGACCGTTGAAGCCGCCCGCCTACCCGGCCGTACCTTTCACCGC
AAAATGCTCTCCTCATTCCGTCTGCAGCTATATTCCATGTACATTGATGACGGACACAATTCGCGCGCAGTTGTG
CTAGCCAACCTCTACTGCAGCTTCATCACTGCTGCCATGAGGATGTACCGCTATATGAAGTCGCTTCGGGGTCGT
GCGCATCCCGGCCCTGCCATCATAACACAGACTATCCGCGATCTGATTCGGCAGACGAACCGTTATATCCAGGCC
CGGCGTGCTGGTAATTCGGAGTCCCCATTCTCGTGTTTCGTTCAGCGATCCCATTTACAGTATCTGGCTTCTGCG
GCATTTCGGTTTGTTTTGAAGCGCAAGCAAACACGGTATGCGGTGGTGCTGCGCTGGCTAGACTCGCTGAGTAAA
GATTCTCGACCCACATCAGATTCCGAGGCTTCGAGAATAGCACAGGTAGTGAAGAAGGGAAATGCCATGTTCGAG
GAATGGCGGTTCTAG
Gene >Pro_DTO377G3_2|g2279.t1
ATGGGCAAAAAGAGGAAAAGACCCATCAAGGACCGCGGGTCCACGTCCTCGTCTCACACGGGTATCACCACGTCT
CCCCGCCGTTTCAGGCCTCCCCATGCGCCAATTCCCCTGGGAACAAAAACAAGCCATCCCGTTATCTCGCTGTAC
TACCGAAATGTCGTACCCTTGCGGGAGTACCTGCTCCATAAACTTCCCGTGACCTCCAAGTCGCGTCGGCGCCGC
ATCCTGACATTGGGCTCGCGGGAAGACCAAGGGACCAATGCACAACTTCAAACGTCTGAGACATTGGCGGAGCTG
CTAGACTCCACACTGGTGGGTGTGCTGAAGGAATCGTCTCCGACCCTTAATTACGAACGACAAAAGCAATACTCC
TCTTTTAATGAGTCTCAATCGCGGTCAATTCTCGTCAGCACCGATACCGGGCCGACTTGTCCCCAATCGGAGGTG
AGCCCATGACGGCCGAATCATTTACAGGTGTCAGATTGCTGATCCTTGTCGCAGGTGGTTGACTTTGTGATCTGG
AAAATCTTCAATCGTAGCAATGGCTACTCTAAAGAGGCCAAGCATCTGCTGACGCATGGCTTCAAACGCATGTCT
ATGCACCATGCTCAACACACTGGTATTCCAGGCATCGTGTCTCAGTTTCCGAATCAGAATGTTCAGGTTCTCAAG
AAGGGTGCATGGGCAGAGGTCCTGGGCTTGCTTGGTAGTAATGGGGAGGAGATTATGATGCAGCTCCTTTTTGAT
TGCGGAGTTTTTGCCCCGATCGACGCTGAAAATGGCATCTACTACCAACTTAGCGGTATGATTCGGTCAAGATGT
AGGGAGAGAGTTGATCCCGGTTTGCTGATATTTTTATAGGTATCCCACTCTCGGATCTCGAGCCTTTGAGCGACG
CATCTGCGGAAGCCAACGGCTCTACTGCCACAGCACAAGACTCAATGCCTACCGCTGGTCAAAGACATCCCAAAG
AGAAAGCTGAATACAAACAGAGTTCCGAGATGCTCCAAAGCCCAAACAACATTGTGTTTATGCGGCGACGTATCC
TCTATGGGCGTGTCGAGTCTAAAAAGGGAGTAGCCTCTGGACTAGGACAGAAACGTACGTGCTTCGCCGTTTGAA
TAATGGATTTTAGGTTTATGCTAATTCCCATTAGATGTTCTTGGCCGCTTCTCAACGCTTGATTCGATGGCGCAA
ACAGTCCATGTTATGAAGTACATATTTCCCCGTCAATTCGGCCTGCTGAATGTATTTACGCTGGACTCGGATCAA
CGCAAGCAGATGAATGACTCGAATGGTTTCATGTCTCGTGAGAGTGAGATATCTCTTTTGGAAGAACAGAAACGA
CCACAGGGGCCTCAGACTGGGAGTGAATCAGCAGATGCAGGTTGTGGTGGCGTGAAAAGTGTCAAGGTACCTAAG
AGGCTTCGTGGAATTACTATAGAGCTTGTCCGGAAGCTCCGGAACCGCAACGCACAATGCTCCTACGGAGAGTTG
CTGCGATACTATTGTCCAACCGAAGTGAGACACTTTTGTTTACATTGGCTAGGATTGTGTAGCTGACCTTTGGCA
GCAAACCGAACCCAGACTCCTTGGCGCATCTGTCTCCACAACTGATGCTAAAAAAAGCGAGCCTATCTCCTCTCT
CGAGTCAAATTTTGTAACACAGGTGAACTACCCGTCGCCAAGTGATAGTTCGCAGACCTCATGTGATGGCGCGAG
ATCAGAGCCGCACATAGCTGTCGACACATCTTGTGGAAACGATGCCGAGAAACCGGTGATCCGAAAGACTCAAGT
CAGTCTAACTGATCATGCGACTCCGCCATCTTCTGTCTCGGCATTTTGTCGAGCGGTAATCCAGAAATTGATCCC
ACGGCAGTTTTGGGGGGTTGGTCCAGATGGTATTTCGAACTTCAAGCTGGTTCTCAGGCATGTTGACCGATTTAT
CAAATTGCGCCGATTCGAAAGTCTAAGTCTGCACGAAGTCTGCAAAGGTGTCAAGGTTGGTCATTGCTTGCACTG
AACTGATCGTCTGAGACAAAGCCGTACTGATCCGCACGCTAGATAACAAGCATTCCTTGGCTGGCGCCACCCCAG
GTCCAGACTAGTCTGCCATCTGAGACAAGATCGAAGATCGCCCTGTCTGACTTGCACAAACGCACCGAGCTACTC
CATGAATTCATGTTTTGGATTTTCGATTCACTCCTTATTCCTCTCATTCGTTCGCATTTCTATGTCACCGAGTCT
CAAGTGCACCGAAACCGCCTTTTCTATTTCCGCCATGATGTGTGGCAGCAGTTGACCCAGCAACCTTTCGGTGAC
TTGAAGGCAATGATGTTCGAGGAGCTTGAGTCAGATCAAGCCCAACGTGTGCTGGCGCGGCGGTCCTTTGGTTTC
GGTGCTCTCCGTTTGCTTCCCAAGTCTACAGGCATCCGGCCCATCTTGAACCTTCGCAAACGAGATTTGAAGACA
CGGTCATGGGGGAAACGGGAAACGTACCTTGGCATCAGCATCAATTCAAGTATTACGCCTATTTATAACATGTTG
ACCTATGAGCGTGAGCAAGCTCCTGCCAAATTGGGCTCGTCGATACTCTCCGTTGCAGATATGCACCGCCGATTG
AAGGCGTACAAAGAACAATTGTCCCAACGACTGCCCTCGGCTTCTAGACCTTGGCAATCCAAGCTCCCACCGATG
TACTTTGTCAAGGTTGATATCAAAGCTTGTTTTGATACTATCCCCCAGAAAAAGCTGCTTAATCTTATCGAAGAG
CTGGTCTCTGAAGAGAGCTACTGCATCGCAAAGCACACCGAGATCCACCCGCCCACTTCTACTGCGAAACAAGGA
AAGCCCATACGAAGGTTTCTGAGTCGCGCTACTCCTGCTATGAAACCGCAACACCTACCAGACTACGTCAATAGC
GAAAGCACGACCCGAAAGGCCAACACCGTTTTTGTTGAGTGTGGTCAAAAAGAAAATGATGCTGATAGTCTTCTG
GAACTTCTCAGTGAACATGTCCAGAACAACCTCGTGAAGATAGGCAAGAGATTTTTCCGCCAACGCAACGGCATT
CCTCAAGGCTCCGTGCTATCAAGCCTCCTTTGCAATTTCTTCTATGCCGAGCTTGAGCGAAAGGTACTGAATTTC
ATCAAACCCGAGGATTCTCTTCTCCTGCGACTCGTGGACGATTTCCTTCTGGTCACCCCGGATGTAGCTGTGGCA
ATGCAGTTTCTGGAAGTAATGATCAGGGGCCAACCATCGTACGGTGTACAGGTCAATCCAGCGAAAAGCATGGCC
AATTTCAGCGCAGCGGTTGACGGGATTTTACTTCCCAGATTAGAGGGAAGCACATTATTTCCGTATTGCGGTAGT
CTCATCGACACTCACACGCTGGAATTTCACCGCGATCAAGACCGCATCCTTCAGGGCGGCGAGTCGGCTGCTGCT
ACTCTCTCCGATGCCTTGACCGTTGAAGCCGCCCGCCTACCCGGCCGTACCTTTCACCGCAAAATGCTCTCCTCA
TTCCGTCTGCAGCTATATTCCATGTACATTGATGACGGACACAATTCGCGCGCAGTTGTGCTAGCCAACCTCTAC
TGCAGCTTCATCACTGCTGCCATGAGGATGTACCGCTATATGAAGTCGCTTCGGGGTCGTGCGCATCCCGGCCCT
GCCATCATAACACAGACTATCCGCGATCTGATTCGGCAGACGAACCGTTATATCCAGGCCCGGCGTGCTGGTAAT
TCGGAGTCCCCATTCTCGTGTTTCGTTCAGCGATCCCATTTACAGTATCTGGCTTCTGCGGCATTTCGGTTTGTT
TTGAAGCGCAAGCAAACACGGTATGCGGTGGTGCTGCGCTGGCTAGACTCGCTGAGTAAAGATTCTCGACCCACA
TCAGATTCCGAGGCTTCGAGAATAGCACAGGTAGTGAAGAAGGGAAATGCCATGTTCGAGGAATGGCGGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail