Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2276.t1
Gene name
Locationscaffold_02:2117747..2120605
Strand-
Gene length (bp)2858
Transcript length (bp)2622
Coding sequence length (bp)2622
Protein length (aa) 874

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00888 Cullin Cullin family 9.3E-183 146 773
PF10557 Cullin_Nedd8 Cullin protein neddylation domain 1.3E-23 804 865

GO

GO Term Description Terminal node
GO:0031625 ubiquitin protein ligase binding Yes
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0044248 cellular catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0008150 biological_process No
GO:0044389 ubiquitin-like protein ligase binding No
GO:0019899 enzyme binding No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0005488 binding No
GO:0009056 catabolic process No
GO:0005515 protein binding No
GO:0044265 cellular macromolecule catabolic process No
GO:0003674 molecular_function No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:0006508 proteolysis No
GO:1901575 organic substance catabolic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2276.t1
MPQNSRGDTEQSGKRQSIGKRKLSDQGEPSQPRSQQSISELLSQRYSPDRSLDLQTHKRSRLSSSPSRSSTQTSP
HKMHPISGSPPKNGVPGRGVSGLNGPIRSHGLNTNIRQNTFSPHSGAKKLVVKNLRTGPRLNQESYFDKVWSQLD
AALTAIFDDRKPESSLEELYKGGENVCRQERAALLAKKLQDRCKEFVSGKMRTNLVARAGGSTDVGTLRIVIEAW
SAWHSKLVTIRWIFYYLDQSFLLHSKEQPVIREMGLIQFRSYIFSDASLKPKIVKGAYDLIEADRGGFTKALTDS
SLLRDAIELFHSLDVYGSDFEPLFMAKSEEFVKQWSQQQAAGSLAAYVDNSHQLIEREVERCGLFSFNRSTKLKL
SNLLDETLVTRRTDVLTNENEVLGLMRAGNKTALKQLYGLLDRRDLSLELKPAFRKYIIEEGEGIVFNQDLEADM
VIHLLQFKQKVDDICTDSFESNEELGHTVRDAFGTFMNHGKKMDSTGGTDNPKSGEMIAKYVDRLLKGGYKLPPG
RNPEEVSLMSDDAELDRQLDQVLDLFRFVHGKAVFEAFYKNDLARRLLMKRSASNDAEKSMLTRLKNECGSNFTH
NLESMFNDMDTANDEMTAFRRSQQDERRSRFEFEVSVLSAASWPTYPDVPVRIPSTIARSISRFETFYHNKHTGR
KLTWKHQLAHCQLTANFPLGKKNLVVSSFQAIVLLLFNDIPNGESMQYPQIQEATGLSDPELKRTLQSLACAKYR
VLSKDPKGKEVNSSDKFSYNANFSDKQMRIKINQIQLKETKEETKTTHERVAADRHFETQAAIVRIMKGRKTLSH
AELIAEVISATKTRGVLQPADIKGEIEKLIEKEYLERKEGTNQYSYVS*
Coding >Pro_DTO377G3_2|g2276.t1
ATGCCGCAGAACTCGAGAGGCGACACCGAGCAGAGCGGTAAGCGCCAATCAATCGGCAAGAGGAAGCTTTCTGAT
CAAGGAGAGCCGTCGCAGCCGCGATCGCAACAATCCATATCCGAGCTCCTCTCCCAGAGGTATTCACCCGACCGC
AGCCTTGATCTGCAAACCCACAAGCGTTCCCGTCTGTCGTCGTCTCCCTCACGCTCCTCAACCCAAACGAGCCCG
CATAAGATGCATCCGATTTCCGGTTCCCCGCCTAAGAATGGCGTGCCAGGTCGGGGAGTCTCTGGGTTAAATGGT
CCCATCAGATCCCATGGCTTGAATACTAATATCCGCCAAAACACATTTTCTCCTCATAGCGGCGCGAAAAAGCTC
GTCGTCAAGAACCTTCGTACCGGACCGCGGCTTAACCAGGAATCGTATTTCGATAAAGTGTGGTCGCAGTTGGAT
GCGGCTCTAACGGCTATTTTTGATGACAGGAAACCAGAGAGCTCGCTAGAAGAGCTATACAAGGGCGGGGAGAAT
GTCTGCCGCCAGGAGCGGGCAGCTTTGTTGGCTAAGAAGCTTCAGGATCGGTGCAAAGAGTTCGTCAGCGGGAAA
ATGCGCACGAATCTTGTCGCCAGAGCTGGAGGTAGCACTGATGTCGGTACATTGCGGATAGTGATTGAGGCGTGG
TCGGCCTGGCACTCCAAGCTAGTTACTATTCGCTGGATCTTCTATTATCTCGACCAGTCGTTCCTCTTGCATTCT
AAAGAACAACCGGTGATTCGTGAAATGGGATTGATTCAGTTCCGGTCATACATCTTCTCTGATGCGAGTCTGAAG
CCAAAGATTGTGAAAGGAGCATATGATTTGATCGAGGCCGATCGAGGTGGATTTACAAAGGCATTGACAGATTCA
AGTTTGCTTAGAGATGCTATTGAGCTTTTCCACAGCCTCGATGTGTATGGGAGTGACTTTGAGCCTTTATTCATG
GCCAAGTCCGAGGAGTTTGTGAAGCAGTGGTCTCAACAACAAGCAGCAGGGTCCCTGGCTGCATACGTCGATAAT
TCCCACCAGTTGATCGAACGTGAGGTAGAACGGTGTGGTCTCTTCTCTTTCAATCGAAGCACGAAGCTCAAACTG
TCCAATCTCCTGGATGAGACTCTAGTGACACGGCGAACGGACGTGTTGACCAACGAAAACGAAGTGCTTGGCTTG
ATGCGAGCCGGCAATAAGACTGCCTTGAAGCAACTATACGGTTTGCTTGACCGGCGAGATCTTAGTCTCGAATTG
AAGCCTGCATTTAGGAAGTACATCATCGAGGAGGGTGAGGGCATCGTGTTTAATCAAGATCTGGAGGCCGACATG
GTCATTCACCTGCTCCAATTTAAGCAAAAGGTTGACGATATTTGCACCGATTCTTTTGAGTCGAATGAGGAACTG
GGCCACACGGTCCGCGACGCCTTTGGTACCTTTATGAACCACGGGAAGAAGATGGACTCTACAGGTGGTACCGAC
AATCCCAAGTCGGGTGAAATGATCGCCAAATACGTGGATAGGCTCCTTAAGGGCGGTTACAAGCTGCCACCAGGC
CGTAACCCAGAGGAAGTAAGCCTGATGTCCGATGATGCAGAGCTTGACCGACAGCTTGATCAAGTTCTCGACCTC
TTCCGATTCGTACATGGAAAGGCTGTCTTTGAAGCCTTTTACAAGAACGATCTTGCCCGGCGTCTTTTGATGAAA
CGAAGCGCGAGCAACGATGCGGAAAAGAGCATGTTAACTCGTTTGAAGAACGAATGCGGGTCAAATTTCACTCAT
AACCTTGAGTCCATGTTCAACGATATGGACACTGCTAACGATGAAATGACGGCCTTCAGACGGTCACAGCAGGAC
GAGCGCAGGAGCCGATTCGAATTCGAAGTTAGCGTGCTCTCTGCCGCCTCCTGGCCGACATATCCCGATGTACCC
GTACGGATTCCATCGACGATCGCACGCTCCATTAGCAGATTCGAGACGTTCTACCACAACAAACATACAGGACGC
AAGCTCACCTGGAAACATCAACTGGCGCATTGTCAGCTGACTGCAAACTTCCCGCTCGGAAAGAAGAACCTGGTA
GTCAGCTCGTTCCAGGCGATTGTGTTGCTGCTCTTTAACGATATCCCCAATGGCGAGAGCATGCAGTACCCCCAG
ATCCAAGAAGCGACCGGATTGTCGGACCCGGAATTGAAACGAACGCTCCAGTCTCTCGCATGCGCCAAGTACCGA
GTCTTATCCAAGGACCCTAAGGGCAAAGAGGTGAACTCTAGCGATAAATTCTCGTACAACGCGAATTTCAGCGAC
AAGCAAATGCGCATCAAGATCAACCAGATCCAGCTGAAGGAGACCAAAGAGGAAACCAAGACGACGCACGAGCGG
GTTGCTGCCGACCGCCATTTCGAGACGCAAGCTGCCATCGTGCGCATTATGAAGGGCCGCAAGACCCTCAGCCAC
GCCGAGCTGATCGCGGAGGTTATCAGTGCTACTAAGACCCGGGGTGTGCTTCAGCCGGCCGATATTAAGGGAGAG
ATTGAGAAGTTGATCGAGAAGGAGTATCTCGAGCGCAAAGAAGGCACTAATCAATACAGCTACGTGTCATAA
Transcript >Pro_DTO377G3_2|g2276.t1
ATGCCGCAGAACTCGAGAGGCGACACCGAGCAGAGCGGTAAGCGCCAATCAATCGGCAAGAGGAAGCTTTCTGAT
CAAGGAGAGCCGTCGCAGCCGCGATCGCAACAATCCATATCCGAGCTCCTCTCCCAGAGGTATTCACCCGACCGC
AGCCTTGATCTGCAAACCCACAAGCGTTCCCGTCTGTCGTCGTCTCCCTCACGCTCCTCAACCCAAACGAGCCCG
CATAAGATGCATCCGATTTCCGGTTCCCCGCCTAAGAATGGCGTGCCAGGTCGGGGAGTCTCTGGGTTAAATGGT
CCCATCAGATCCCATGGCTTGAATACTAATATCCGCCAAAACACATTTTCTCCTCATAGCGGCGCGAAAAAGCTC
GTCGTCAAGAACCTTCGTACCGGACCGCGGCTTAACCAGGAATCGTATTTCGATAAAGTGTGGTCGCAGTTGGAT
GCGGCTCTAACGGCTATTTTTGATGACAGGAAACCAGAGAGCTCGCTAGAAGAGCTATACAAGGGCGGGGAGAAT
GTCTGCCGCCAGGAGCGGGCAGCTTTGTTGGCTAAGAAGCTTCAGGATCGGTGCAAAGAGTTCGTCAGCGGGAAA
ATGCGCACGAATCTTGTCGCCAGAGCTGGAGGTAGCACTGATGTCGGTACATTGCGGATAGTGATTGAGGCGTGG
TCGGCCTGGCACTCCAAGCTAGTTACTATTCGCTGGATCTTCTATTATCTCGACCAGTCGTTCCTCTTGCATTCT
AAAGAACAACCGGTGATTCGTGAAATGGGATTGATTCAGTTCCGGTCATACATCTTCTCTGATGCGAGTCTGAAG
CCAAAGATTGTGAAAGGAGCATATGATTTGATCGAGGCCGATCGAGGTGGATTTACAAAGGCATTGACAGATTCA
AGTTTGCTTAGAGATGCTATTGAGCTTTTCCACAGCCTCGATGTGTATGGGAGTGACTTTGAGCCTTTATTCATG
GCCAAGTCCGAGGAGTTTGTGAAGCAGTGGTCTCAACAACAAGCAGCAGGGTCCCTGGCTGCATACGTCGATAAT
TCCCACCAGTTGATCGAACGTGAGGTAGAACGGTGTGGTCTCTTCTCTTTCAATCGAAGCACGAAGCTCAAACTG
TCCAATCTCCTGGATGAGACTCTAGTGACACGGCGAACGGACGTGTTGACCAACGAAAACGAAGTGCTTGGCTTG
ATGCGAGCCGGCAATAAGACTGCCTTGAAGCAACTATACGGTTTGCTTGACCGGCGAGATCTTAGTCTCGAATTG
AAGCCTGCATTTAGGAAGTACATCATCGAGGAGGGTGAGGGCATCGTGTTTAATCAAGATCTGGAGGCCGACATG
GTCATTCACCTGCTCCAATTTAAGCAAAAGGTTGACGATATTTGCACCGATTCTTTTGAGTCGAATGAGGAACTG
GGCCACACGGTCCGCGACGCCTTTGGTACCTTTATGAACCACGGGAAGAAGATGGACTCTACAGGTGGTACCGAC
AATCCCAAGTCGGGTGAAATGATCGCCAAATACGTGGATAGGCTCCTTAAGGGCGGTTACAAGCTGCCACCAGGC
CGTAACCCAGAGGAAGTAAGCCTGATGTCCGATGATGCAGAGCTTGACCGACAGCTTGATCAAGTTCTCGACCTC
TTCCGATTCGTACATGGAAAGGCTGTCTTTGAAGCCTTTTACAAGAACGATCTTGCCCGGCGTCTTTTGATGAAA
CGAAGCGCGAGCAACGATGCGGAAAAGAGCATGTTAACTCGTTTGAAGAACGAATGCGGGTCAAATTTCACTCAT
AACCTTGAGTCCATGTTCAACGATATGGACACTGCTAACGATGAAATGACGGCCTTCAGACGGTCACAGCAGGAC
GAGCGCAGGAGCCGATTCGAATTCGAAGTTAGCGTGCTCTCTGCCGCCTCCTGGCCGACATATCCCGATGTACCC
GTACGGATTCCATCGACGATCGCACGCTCCATTAGCAGATTCGAGACGTTCTACCACAACAAACATACAGGACGC
AAGCTCACCTGGAAACATCAACTGGCGCATTGTCAGCTGACTGCAAACTTCCCGCTCGGAAAGAAGAACCTGGTA
GTCAGCTCGTTCCAGGCGATTGTGTTGCTGCTCTTTAACGATATCCCCAATGGCGAGAGCATGCAGTACCCCCAG
ATCCAAGAAGCGACCGGATTGTCGGACCCGGAATTGAAACGAACGCTCCAGTCTCTCGCATGCGCCAAGTACCGA
GTCTTATCCAAGGACCCTAAGGGCAAAGAGGTGAACTCTAGCGATAAATTCTCGTACAACGCGAATTTCAGCGAC
AAGCAAATGCGCATCAAGATCAACCAGATCCAGCTGAAGGAGACCAAAGAGGAAACCAAGACGACGCACGAGCGG
GTTGCTGCCGACCGCCATTTCGAGACGCAAGCTGCCATCGTGCGCATTATGAAGGGCCGCAAGACCCTCAGCCAC
GCCGAGCTGATCGCGGAGGTTATCAGTGCTACTAAGACCCGGGGTGTGCTTCAGCCGGCCGATATTAAGGGAGAG
ATTGAGAAGTTGATCGAGAAGGAGTATCTCGAGCGCAAAGAAGGCACTAATCAATACAGCTACGTGTCATAA
Gene >Pro_DTO377G3_2|g2276.t1
ATGCCGCAGAACTCGAGAGGCGACACCGAGCAGAGCGGTAAGCGCCAATCAATCGGCAAGAGGAAGCTTTCTGAT
CAAGGAGAGCCGTCGCAGCCGCGATCGCAACAATCCATATCCGAGCTCCTCTCCCAGAGGTATTCACCCGACCGC
AGCCTTGATCTGCAAACCCACAAGCGTTCCCGTCTGTCGTCGTCTCCCTCACGCTCCTCAACCCAAACGAGCCCG
CATAAGATGCATCCGATTTCCGGTTCCCCGCCTAAGAATGGCGTGCCAGGTCGGGGAGTCTCTGGGTTAAATGGT
CCCATCAGATCCCATGGCTTGAATACTAATATCCGCCAAAACACATTTTCTCCTCATAGCGGCGCGAAAAAGCTC
GTCGTCAAGAACCTTCGTACCGGACCGCGGCTTAACCAGGAATCGTATTTCGATAAAGTGTGGTCGCAGTTGGAT
GCGGCTCTAACGGCTATTTTTGATGACAGGAAACCAGAGAGCTCGCTAGAAGAGCTATACAAGGGCGGGGAGAAT
GTCTGCCGCCAGGAGCGGGCAGCTTTGTTGGCTAAGAAGCTTCAGGATCGGTGCAAAGAGTTCGTCAGCGGGAAA
ATGCGCACGAATCTTGTCGCCAGAGCTGGAGGTAGCACTGATGTCGGTACATTGCGGATAGTGATTGAGGCGTGG
TCGGCCTGGCACTCCAAGCTAGTATGTGTGGCAAGGAAATATCTCGAATGGAGGTTCACAGCTAACGGTCTCTCT
CCCCCAGGTTACTATTCGCTGGATCTTCTATTATCTCGACCAGTCGTTCCTCTTGCATTCTAAAGAACAACCGGT
GATTCGTGAAATGGGATTGATTCAGTTCCGGTCATACATCTTCTCTGATGCGAGTCTGAAGCCAAAGATTGTGAA
AGGAGCATATGATTTGATCGAGGCCGATCGAGGTGGATTTACAAAGGCATTGACAGATTCAAGTTTGCTTAGAGA
TGCTATTGAGCTTTTCCACAGCCTCGATGTGTATGGGAGTGACTTTGAGCCTTTATTCATGGCCAAGTCCGAGGA
GTTTGTGAAGCAGTGGTCTCAACAACAAGCAGCAGGGTCCCTGGCTGCATACGTCGATAATTCCCACCAGTTGAT
CGAACGTGAGGTAGAACGGTGTGGTCTCTTCTCTTTCAATCGAAGCACGAAGCTCAAACTGTCCAATCTCCTGGA
TGAGACTCTAGTGACACGGCGAACGGACGTGTTGACCAACGAAAACGAAGTGCTTGGCTTGATGCGAGCCGGCAA
TAAGACTGCCTTGAAGCAACTATACGGTTTGCTTGACCGGCGAGATCTTAGTCTCGAATTGAAGCCTGCATTTAG
GAAGTACATCATCGAGGAGGGTGAGGGCATCGTGTTTAATCAAGATCTGGAGGCCGACATGGTCATTCACCTGCT
CCAATTTAAGCAAAAGGTTGACGATATTTGCACCGATTCTTTTGAGTCGAATGAGGAACTGGGCCACACGGTCCG
CGACGCCTTTGGTACCTTTATGAACCACGGGAAGAAGATGGACTCTACAGGTGGTACCGACAATCCCAAGTCGGG
TGAAATGATCGCCAAATACGTGGATAGGCTCCTTAAGGGCGGTTACAAGCTGCCACCAGGCCGTAACCCAGAGGA
AGTAAGCCTGATGTCCGATGATGCAGAGCTTGACCGACAGCTTGATCAAGTTCTCGACCTCTTCCGATTCGTACA
TGGAAAGGCTGTCTTTGAAGCCTTTTACAAGAACGATCTTGCCCGGCGTCTTTTGATGAAACGAAGCGCGAGCAA
CGATGCGGAAAAGAGCATGTTAACTCGTTTGAAGAACGGTTTGTCGCATCCAAGATCCATATGTTATGCGCTTTG
GCTAATGTTTGGTTAGAATGCGGGTCAAATTTCACTCATAACCTTGAGTCCATGTTCAACGATATGGACACTGCT
AACGATGAAATGACGGCCTTCAGACGGTCACAGCAGGACGAGCGCAGGAGCCGATTCGAATTCGAAGTTAGCGTG
CTCTCTGCCGCCTCCTGGCCGACATATCCCGATGTACCCGTACGGATTCCATCGACGATCGCACGCTCCATTAGC
AGATTCGAGACGTTCTACCACAACAAACATACAGGACGCAAGCTCACCTGGAAACATCAACTGGCGCATTGTCAG
CTGACTGCAAACTTCCCGCTCGGAAAGAAGAACCTGGTAGTCAGCTCGTTCCAGGCGATTGTGTTGCTGCTCTTT
AACGATATCCCCAATGGCGAGAGCATGCAGTACCCCCAGATCCAAGAAGCGACCGGATTGTGTAAGTGGATCCAC
AGCGCTCTAAAAGTTGAACAATCCCTAACATGACACACAGCGGACCCGGAATTGAAACGAACGCTCCAGTCTCTC
GCATGCGCCAAGTACCGAGTCTTATCCAAGGACCCTAAGGGCAAAGAGGTGAACTCTAGCGATAAATTCTCGTAC
AACGCGAATTTCAGCGACAAGCAAATGCGCATCAAGATCAACCAGATCCAGCTGAAGGAGACCAAAGAGGAAACC
AAGACGACGCACGAGCGGGTTGCTGCCGACCGCCATTTCGAGACGCAAGCTGCCATCGTGCGCATTATGAAGGGC
CGCAAGACCCTCAGCCACGCCGAGCTGATCGCGGAGGTTATCAGTGCTACTAAGACCCGGGGTGTGCTTCAGCCG
GCCGATATTAAGGGAGAGATTGAGAAGTGCGTATCCTCCTTACTAACAACCCGTTGTTCCCGGTTATTGTGTCTA
ACATTGTTTTGACTTTTAGGTTGATCGAGAAGGAGTATCTCGAGCGCAAAGAAGGCACTAATCAATACAGCTACG
TGTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail