Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2258.t1
Gene name
Locationscaffold_02:2071404..2073174
Strand-
Gene length (bp)1770
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06963 FPN1 Ferroportin1 (FPN1) 5.5E-144 46 456

GO

GO Term Description Terminal node
GO:0005381 iron ion transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0034755 iron ion transmembrane transport Yes
GO:0055085 transmembrane transport No
GO:0030001 metal ion transport No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0098655 cation transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0098660 inorganic ion transmembrane transport No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0098662 inorganic cation transmembrane transport No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0046873 metal ion transmembrane transporter activity No
GO:0006826 iron ion transport No
GO:0000041 transition metal ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 67 89 22
2 202 224 22
3 281 303 22
4 350 372 22
5 445 467 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 27.43 14.84 40.02
5d_25C Five days - 25 degrees Celsius 48.61 28.90 68.32
7d_25C Seven days - 25 degrees Celsius 48.21 28.52 67.90
10d_25C Ten days - 25 degrees Celsius 56.99 34.13 79.86
7d_15C Seven days - 15 degrees Celsius 35.31 19.89 50.73
7d_30C Seven days - 30 degrees Celsius 44.02 25.90 62.14

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.013810 yes
3d_25C 7d_25C 0.015558 yes
3d_25C 7d_15C 0.367713 no
3d_25C 7d_30C 0.045183 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.982839 no
5d_25C 7d_15C 0.187119 no
5d_25C 7d_30C 0.741224 no
5d_25C 10d_25C 0.555681 no
7d_25C 7d_15C 0.210485 no
7d_25C 7d_30C 0.764620 no
7d_25C 10d_25C 0.536401 no
7d_15C 7d_30C 0.414943 no
7d_15C 10d_25C 0.037981 yes
7d_30C 10d_25C 0.290026 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2258.t1
MVLGSEFPEPSRQPSEDISNSSNPLLPTLADDGPPQNDSPAPEAHSVLTRLYISHTLSTWNSRMFEFGAVLFLAS
IFPGTLLYASIYALVRAFSAVALSSWLGAQVDRSDRLVAVRHSIVWQRVPVAISCLCFVATLSTDSWSLTIALFT
VQGLLACMEKLAATANTVAVERDWAIVISESINVPRQDLNASMRRIDLFCKLLAPVFISLIDSISTPYAIWTVFT
MNTASVLVEYLAIAQVYQSVPALTKTQAPTTQADDTNGKSDTRCLSSSLAPWKEYIASPVFLASFALSLLYLTVL
SFGATMVTYLLHTGFTPLEVSYMRIGSVVAELSGTWTAPMVMNRIGPIRSGLWFLNWQFICIAAATVAFVFWDPS
SQFVAGALITGVALSRIGLWGFDLSVQFLVQENIQEHARARFSATEMALQNVFEMLSFASTIAFPLPAQFRYPVM
ISSGAVAVAAICFATYVRKERGHLLHRSRCMGGDKVSYRAIGSGSV*
Coding >Pro_DTO377G3_2|g2258.t1
ATGGTTCTTGGGAGCGAGTTCCCAGAGCCTAGCCGGCAACCATCAGAAGACATCAGCAATTCCTCCAACCCTCTG
TTGCCGACCTTGGCGGATGATGGCCCACCCCAAAATGATAGCCCAGCACCAGAAGCCCACTCAGTACTAACACGC
CTATACATATCTCACACACTCTCAACATGGAACTCCCGCATGTTTGAATTCGGCGCCGTACTCTTCCTAGCTTCG
ATCTTCCCGGGGACACTACTGTATGCTTCGATATACGCTCTAGTGCGGGCGTTTTCAGCCGTCGCGCTGTCGTCG
TGGCTGGGTGCGCAAGTTGATCGCTCAGACCGGCTCGTTGCTGTGAGGCATTCCATTGTGTGGCAAAGAGTCCCT
GTCGCGATCTCATGCTTATGCTTTGTGGCCACTCTGTCTACAGACTCTTGGTCGCTTACAATTGCCTTGTTCACC
GTGCAGGGCTTACTGGCTTGTATGGAGAAATTGGCCGCTACGGCTAATACGGTGGCTGTGGAACGGGACTGGGCA
ATCGTGATCTCGGAAAGTATCAATGTCCCTCGACAAGACTTGAACGCCTCTATGAGACGAATTGATCTCTTCTGC
AAGCTCCTAGCACCAGTATTCATCTCCTTGATCGACAGCATATCAACCCCATATGCAATTTGGACAGTGTTTACC
ATGAATACCGCATCTGTGCTGGTCGAGTATTTGGCCATTGCTCAGGTCTACCAATCAGTCCCGGCCTTGACCAAG
ACACAAGCTCCTACAACACAAGCAGATGATACAAATGGCAAGAGCGATACCCGCTGCTTGTCAAGCTCACTAGCG
CCCTGGAAAGAGTACATAGCAAGTCCCGTCTTCCTAGCATCCTTTGCCCTGAGCCTGCTCTACCTAACAGTCCTA
TCCTTTGGCGCAACAATGGTAACATACCTGTTGCACACGGGCTTCACCCCGTTGGAGGTCAGCTATATGCGCATC
GGCTCCGTGGTCGCCGAGCTATCTGGGACATGGACAGCGCCTATGGTCATGAACCGGATTGGTCCGATTCGCTCC
GGGCTGTGGTTTCTGAATTGGCAGTTTATCTGCATCGCTGCTGCCACCGTGGCTTTCGTTTTCTGGGACCCTAGC
TCGCAGTTCGTAGCGGGTGCGCTGATTACGGGCGTTGCTTTGAGTCGGATTGGGCTTTGGGGATTCGATTTGTCG
GTCCAGTTTCTCGTGCAGGAGAATATCCAGGAACATGCCCGTGCCCGCTTCTCTGCTACTGAAATGGCGCTGCAG
AATGTGTTCGAGATGCTTTCTTTTGCCTCGACTATTGCTTTCCCGCTGCCGGCCCAGTTCAGGTATCCCGTGATG
ATCAGTTCTGGGGCTGTGGCGGTCGCTGCGATCTGTTTTGCGACGTATGTGCGCAAGGAACGGGGACACCTACTG
CATCGATCACGCTGTATGGGCGGAGATAAAGTGTCATATCGAGCGATTGGATCTGGGTCGGTTTAG
Transcript >Pro_DTO377G3_2|g2258.t1
ATGGTTCTTGGGAGCGAGTTCCCAGAGCCTAGCCGGCAACCATCAGAAGACATCAGCAATTCCTCCAACCCTCTG
TTGCCGACCTTGGCGGATGATGGCCCACCCCAAAATGATAGCCCAGCACCAGAAGCCCACTCAGTACTAACACGC
CTATACATATCTCACACACTCTCAACATGGAACTCCCGCATGTTTGAATTCGGCGCCGTACTCTTCCTAGCTTCG
ATCTTCCCGGGGACACTACTGTATGCTTCGATATACGCTCTAGTGCGGGCGTTTTCAGCCGTCGCGCTGTCGTCG
TGGCTGGGTGCGCAAGTTGATCGCTCAGACCGGCTCGTTGCTGTGAGGCATTCCATTGTGTGGCAAAGAGTCCCT
GTCGCGATCTCATGCTTATGCTTTGTGGCCACTCTGTCTACAGACTCTTGGTCGCTTACAATTGCCTTGTTCACC
GTGCAGGGCTTACTGGCTTGTATGGAGAAATTGGCCGCTACGGCTAATACGGTGGCTGTGGAACGGGACTGGGCA
ATCGTGATCTCGGAAAGTATCAATGTCCCTCGACAAGACTTGAACGCCTCTATGAGACGAATTGATCTCTTCTGC
AAGCTCCTAGCACCAGTATTCATCTCCTTGATCGACAGCATATCAACCCCATATGCAATTTGGACAGTGTTTACC
ATGAATACCGCATCTGTGCTGGTCGAGTATTTGGCCATTGCTCAGGTCTACCAATCAGTCCCGGCCTTGACCAAG
ACACAAGCTCCTACAACACAAGCAGATGATACAAATGGCAAGAGCGATACCCGCTGCTTGTCAAGCTCACTAGCG
CCCTGGAAAGAGTACATAGCAAGTCCCGTCTTCCTAGCATCCTTTGCCCTGAGCCTGCTCTACCTAACAGTCCTA
TCCTTTGGCGCAACAATGGTAACATACCTGTTGCACACGGGCTTCACCCCGTTGGAGGTCAGCTATATGCGCATC
GGCTCCGTGGTCGCCGAGCTATCTGGGACATGGACAGCGCCTATGGTCATGAACCGGATTGGTCCGATTCGCTCC
GGGCTGTGGTTTCTGAATTGGCAGTTTATCTGCATCGCTGCTGCCACCGTGGCTTTCGTTTTCTGGGACCCTAGC
TCGCAGTTCGTAGCGGGTGCGCTGATTACGGGCGTTGCTTTGAGTCGGATTGGGCTTTGGGGATTCGATTTGTCG
GTCCAGTTTCTCGTGCAGGAGAATATCCAGGAACATGCCCGTGCCCGCTTCTCTGCTACTGAAATGGCGCTGCAG
AATGTGTTCGAGATGCTTTCTTTTGCCTCGACTATTGCTTTCCCGCTGCCGGCCCAGTTCAGGTATCCCGTGATG
ATCAGTTCTGGGGCTGTGGCGGTCGCTGCGATCTGTTTTGCGACGTATGTGCGCAAGGAACGGGGACACCTACTG
CATCGATCACGCTGTATGGGCGGAGATAAAGTGTCATATCGAGCGATTGGATCTGGGTCGGTTTAG
Gene >Pro_DTO377G3_2|g2258.t1
ATGGTTCTTGGGAGCGAGTTCCCAGAGCCTAGCCGGCAACCATCAGAAGACATCAGCAATTCCTCCAACCCTCTG
TTGCCGACCTTGGCGGATGATGGCCCACCCCAAAATGATAGCCCAGCACCAGAAGCCCACTCAGTACTAACACGC
CTATACATATCTCACACACTCTCAACATGGAACTCCCGCATGTTTGAATTCGGCGCCGTACTCTTCCTAGCTTCG
ATCTTCCCGGGGACACTACTGTATGCTTCGATATACGCTCTAGTGCGGGCGTTTTCAGCCGTCGCGCTGTCGTCG
TGGCTGGGTGCGCAAGTTGATCGCTCAGACCGGCTCGTTGCTGTGAGGCATTCCATTGGTAGGTTGGAATCGTTT
CGGATACTTCAATATGTACCGAGTATCAAGGCCAATGGCTAATTAAAGGAGTAGTGTGGCAAAGAGTCCCTGTCG
CGATCTCATGCTTATGCTTTGTGGCCACTCTGTCTACAGACTCTTGGTCGCTTACAATTGCCTTGTTCACCGTGC
AGGGCTTACTGGCTTGTATGGAGAAATTGGCCGCTACGGCTAATACGGTGGCTGTGGAACGGGACTGGGTATGTA
CGAGGAATCGTATTTGGGTTGTCTGGTTTCCATGCATCCGATATACAATCTTATTTTAGGAAGAGATGTCGCTGA
TAATTTGACACTAGGCAATCGTGATCTCGGAAAGTATCAATGTCCCTCGACAAGGTGAGAACCCTGAAGCTAGCT
GAAGCTCCGCAATATCTAACTTCGAACCACAGACTTGAACGCCTCTATGAGACGAATTGATCTCTTCTGCAAGCT
CCTAGCACCAGTATTCATCTCCTTGATCGACAGCATATCAACCCCATATGCAATTTGGACAGTGTTTACCATGAA
TACCGCATCTGTGCTGGTCGAGTATTTGGCCATTGCTCAGGTCTACCAATCAGTCCCGGCCTTGACCAAGACACA
AGCTCCTACAACACAAGCAGATGATACAAATGGCAAGAGCGATACCCGCTGCTTGTCAAGCTCACTAGCGCCCTG
GAAAGAGTACATAGCAAGTCCCGTCTTCCTAGCATCCTTTGCCCTGAGCCTGCTCTACCTAACAGTCCTATCCTT
TGGCGCAACAATGGTAACATACCTGTTGCACACGGGCTTCACCCCGTTGGAGGTCAGCTATATGCGCATCGGCTC
CGTGGTCGCCGAGCTATCTGGGACATGGACAGCGCCTATGGTCATGAACCGGATTGGTCCGATTCGCTCCGGGCT
GTGGTTTCTGAATTGGCAGTTTATCTGCATCGCTGCTGCCACCGTGGCTTTCGTTTTCTGGGACCCTAGCTCGCA
GTTCGTAGCGGGTGCGCTGATTACGGGCGTTGCTTTGAGTCGGATTGGGCTTTGGGGATTCGATTTGTCGGTCCA
GTTTCTCGTGCAGGAGGTAAGTGGCTTTTCCGTATTCTTGACTTGTGCATGTGCTAAACTTGTTGGGTGATGTAG
AATATCCAGGAACATGCCCGTGCCCGCTTCTCTGCTACTGAAATGGCGCTGCAGAATGTGTTCGAGATGCTTTCT
TTTGCCTCGACTATTGCTTTCCCGCTGCCGGCCCAGTTCAGGTATCCCGTGATGATCAGTTCTGGGGCTGTGGCG
GTCGCTGCGATCTGTTTTGCGACGTATGTGCGCAAGGAACGGGGACACCTACTGCATCGATCACGCTGTATGGGC
GGAGATAAAGTGTCATATCGAGCGATTGGATCTGGGTCGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail