Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2250.t1
Gene name
Locationscaffold_02:2048571..2052018
Strand-
Gene length (bp)3447
Transcript length (bp)3447
Coding sequence length (bp)3447
Protein length (aa) 1149

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00931 NB-ARC NB-ARC domain 1.1E-10 72 302

GO

GO Term Description Terminal node
GO:0043531 ADP binding Yes
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003674 molecular_function No
GO:0030554 adenyl nucleotide binding No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 2.32 0.81 3.84
5d_25C Five days - 25 degrees Celsius 2.15 0.70 3.59
7d_25C Seven days - 25 degrees Celsius 2.05 0.66 3.44
10d_25C Ten days - 25 degrees Celsius 1.36 0.36 2.35
7d_15C Seven days - 15 degrees Celsius 2.48 0.72 4.24
7d_30C Seven days - 30 degrees Celsius 10.36 5.30 15.43

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.884442 no
3d_25C 7d_25C 0.801873 no
3d_25C 7d_15C 0.907092 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.177837 no
5d_25C 7d_25C 0.937569 no
5d_25C 7d_15C 0.786182 no
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.279305 no
7d_25C 7d_15C 0.698638 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.344277 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.145601 no
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2250.t1
MRIITTFRDTLADFILEQSILSLPRGPATEGRNSPVSDLGNSGIFQLCAKETPLFVTPPGFHPNSTFFGMKKELE
VLHSRLFKAKARPEKTMAVLISGVPGSGKTHLARQYVFTQRDCYPGGIFWIDAKSRESTYKCFWEIAQAATLIEQ
KVTVNPEYHETEKYVNAVRLWLQTRKDWLLIFDGVTFERDDDISKFREVLPWSKQCSIIYTSVDKTLRKKRRLYE
PYCLMISRLQVGDACKLLFKDLGITRPTPEQMAKATQIVENYECLPLAIHAIGHRLNATGKPIEKYHVRSQVTDK
KLAEPFLSIMNDLFRLQQKQALHLINLLSFLGHQVPVGLLNLGGAAMAAVNLEIQTSAQSGEDPDLDTTLGTLIH
YGLIERISDADLFQHRSSLRHSDSDPKDVKLVSELSDSLTESSQEGFFSIYRGGSVVDVVKIHSVVQGFCRDELR
IKDEENKGIMSKNDPGFFDTWLIVATRFLITSYDAAMGRMAHYEDCGLVRDYREYETHASRLLELFPKKAAINLH
PLIVRETRETLRRLMKIISKEIDNVSPSSSQYSTRNQKSVFDRSSSSSSSLRDSSDEGPSRRSTFNWSDLESSRA
GTPEHIATPPPQFRLELFPPHIFRQAGYESEEGYETDGEVKTAMSQTSQATEKPNKTPPSFSPPQTAGLAEWHVV
NRHSKQRSNQDTQTKRRSKGPRRFVDTKLNTPLVRLSSIQGKGSSSRTTSAETGGTLMSASEAEQALAAVRRSSN
SQASADVPQPAITSPPSNKENMPTYANVATRRRLEVKSTMKRPSSVPISQASAYLNDDLQIKHSTDSLDSQAGYA
FTSPLYHDVSEDLITEPLSRSTYSEPEFNKFSHHHGADLHTTPGSQAPSRRGSVPHLEVPRNLSASVPFLFPYPP
PPPYDENNSVSLPNRRKSSQLTPGSINSPGALSSIAHPSAIMPRALPSYNAKVHVGSAPERSVPEPMSRDSSAYS
YQSWATEPVRYPPSFQQAEMILNPPLSMQNQQQMLTGTSWTELPLAGNAALQPDPISLSPPASSHGHLGSMEERL
EHPDSGWNQEIEPVQFLHFGEHRVDVQDARLRLHESARLLHPRPHQYQPYHPNLSGPLIQHEGQIYAPASRLEAY
GTRARSGSSPVQPDYAGLDVRFS*
Coding >Pro_DTO377G3_2|g2250.t1
ATGAGAATCATCACAACTTTTAGAGACACCCTGGCTGACTTCATCCTAGAACAATCCATATTATCTCTACCGCGT
GGCCCTGCGACAGAAGGCCGGAATTCCCCAGTATCTGATCTGGGGAACAGTGGAATTTTCCAACTCTGCGCCAAA
GAAACGCCCCTATTCGTGACACCTCCAGGCTTTCATCCTAACTCTACTTTTTTTGGTATGAAGAAAGAACTTGAA
GTGCTGCACAGCCGGCTATTCAAAGCCAAGGCGCGTCCGGAAAAGACAATGGCCGTACTAATCTCCGGCGTTCCA
GGCTCTGGAAAGACACATCTAGCGCGGCAGTACGTTTTTACTCAACGTGACTGCTACCCAGGTGGCATATTTTGG
ATTGACGCCAAGTCCCGTGAATCGACGTACAAGTGTTTTTGGGAGATTGCACAAGCAGCCACGCTAATTGAGCAG
AAGGTGACCGTGAACCCCGAGTACCACGAGACTGAAAAGTACGTGAATGCAGTCCGCCTCTGGCTGCAGACACGC
AAAGATTGGCTCCTCATCTTCGACGGCGTCACCTTCGAGCGCGATGACGATATCAGTAAGTTCAGAGAGGTTCTG
CCCTGGAGCAAACAGTGCAGTATCATATACACCTCGGTCGATAAAACGCTGCGCAAAAAGCGACGACTGTACGAG
CCATATTGCCTGATGATCTCACGGTTGCAAGTGGGTGACGCTTGCAAGCTTCTGTTCAAGGATCTTGGAATTACA
CGACCGACACCCGAGCAAATGGCCAAGGCTACCCAGATAGTTGAGAACTACGAATGTCTACCTCTGGCAATTCAT
GCAATTGGGCACCGTCTCAATGCAACGGGTAAACCGATTGAAAAGTATCATGTCAGATCTCAGGTGACAGACAAG
AAGCTTGCAGAACCTTTCTTGAGTATCATGAACGACTTGTTTCGGTTGCAGCAAAAGCAGGCGCTGCACTTGATT
AATCTTCTCTCGTTTCTTGGCCACCAGGTGCCAGTGGGCCTTCTGAACCTCGGTGGAGCGGCTATGGCCGCCGTG
AACTTAGAGATCCAGACCAGCGCCCAATCCGGAGAAGATCCTGATCTCGATACTACTCTTGGAACCCTCATTCAC
TATGGTTTGATTGAACGGATTTCAGATGCCGATCTCTTTCAGCACAGATCGTCTTTGCGTCACTCTGATAGCGAT
CCTAAGGACGTGAAGCTTGTTTCCGAACTCTCAGATTCCCTGACAGAGAGCAGTCAAGAAGGATTTTTCTCCATA
TACCGGGGTGGATCTGTGGTTGATGTAGTCAAGATCCATAGTGTCGTGCAGGGGTTCTGTCGTGATGAGCTCCGA
ATCAAGGACGAGGAGAACAAAGGCATCATGAGCAAGAATGACCCTGGTTTTTTCGATACTTGGCTGATTGTTGCC
ACTCGTTTTCTCATTACGTCCTACGATGCCGCTATGGGACGAATGGCTCATTACGAAGACTGTGGCCTTGTCCGG
GACTACCGAGAGTACGAAACTCACGCTTCACGACTGCTTGAGCTCTTTCCAAAGAAAGCAGCCATCAATCTCCAT
CCACTGATCGTTCGTGAAACACGAGAGACCTTGCGACGATTGATGAAGATAATAAGCAAAGAGATAGATAATGTG
TCTCCAAGCTCCTCGCAATACTCTACACGGAATCAAAAGTCGGTTTTCGACAGGTCAAGCAGCTCGTCATCATCC
CTCCGCGATTCATCCGACGAAGGCCCATCGCGCCGCTCTACCTTCAACTGGAGTGATCTTGAATCATCTCGAGCG
GGAACGCCTGAGCATATAGCTACACCACCTCCCCAGTTCAGATTAGAGCTTTTCCCTCCACATATCTTCAGGCAA
GCTGGATACGAATCTGAAGAAGGTTATGAAACAGACGGGGAAGTTAAGACAGCCATGTCGCAAACGAGCCAAGCC
ACGGAGAAACCTAACAAGACACCTCCCTCATTCAGTCCTCCACAAACAGCCGGCTTAGCGGAGTGGCATGTGGTC
AATCGACACTCAAAGCAAAGGTCAAATCAAGATACTCAAACAAAGAGGCGCAGCAAAGGCCCTCGTCGCTTTGTA
GATACCAAGTTAAATACCCCACTGGTCAGACTGTCCTCCATCCAAGGAAAGGGATCATCAAGCCGCACAACATCT
GCCGAAACGGGGGGCACTTTGATGTCAGCTTCGGAGGCTGAACAAGCACTTGCTGCAGTGCGTCGGTCTAGCAAT
TCCCAAGCGTCCGCTGACGTTCCGCAGCCTGCAATCACCTCTCCACCATCCAACAAAGAGAATATGCCAACGTAT
GCGAATGTGGCAACTCGACGGAGGTTAGAAGTAAAGTCTACGATGAAGCGCCCGTCATCAGTTCCCATTTCGCAG
GCTTCAGCCTATTTGAATGATGACTTGCAGATAAAACATTCCACTGACTCGCTCGACAGCCAAGCGGGCTACGCC
TTTACATCTCCGCTATACCATGATGTGTCTGAAGATTTGATCACCGAGCCCCTGAGTCGGTCAACCTACAGTGAG
CCTGAGTTCAATAAGTTCAGTCACCATCACGGGGCAGATTTACATACCACGCCTGGATCCCAGGCTCCCTCTCGG
CGTGGCTCAGTGCCACATCTGGAGGTGCCACGAAATCTATCTGCAAGCGTGCCATTCCTCTTTCCATATCCACCG
CCGCCCCCATACGATGAGAACAACTCCGTTTCTCTTCCAAACCGCAGAAAATCGTCTCAATTAACACCAGGCTCA
ATAAATTCCCCAGGGGCTCTTTCTTCCATTGCTCATCCATCCGCAATTATGCCCAGAGCTTTGCCATCATATAAT
GCCAAAGTACACGTGGGGTCAGCCCCAGAGCGCTCAGTTCCCGAGCCGATGTCGCGTGACTCTTCCGCCTACTCT
TATCAATCGTGGGCCACAGAACCCGTGCGATATCCCCCGAGTTTCCAACAGGCCGAGATGATCCTAAATCCACCA
TTGAGCATGCAAAATCAACAGCAAATGTTGACCGGGACTAGCTGGACCGAATTACCTCTGGCAGGCAATGCTGCT
CTCCAGCCAGATCCCATCTCCCTCAGCCCGCCCGCGTCATCGCACGGACACCTCGGCTCCATGGAAGAGCGACTG
GAGCATCCTGACTCGGGCTGGAACCAGGAGATCGAGCCAGTGCAGTTTTTGCATTTTGGCGAGCACCGTGTTGAT
GTACAAGATGCACGACTCCGACTCCATGAATCGGCTCGGCTGTTGCATCCGCGGCCCCACCAGTATCAGCCGTAC
CATCCCAACTTGTCGGGTCCTTTGATTCAGCATGAGGGACAAATCTATGCGCCGGCTTCGCGACTGGAGGCATAC
GGGACTCGTGCGCGTAGTGGAAGCTCCCCTGTGCAACCTGACTATGCTGGTTTGGATGTGCGGTTCTCATAA
Transcript >Pro_DTO377G3_2|g2250.t1
ATGAGAATCATCACAACTTTTAGAGACACCCTGGCTGACTTCATCCTAGAACAATCCATATTATCTCTACCGCGT
GGCCCTGCGACAGAAGGCCGGAATTCCCCAGTATCTGATCTGGGGAACAGTGGAATTTTCCAACTCTGCGCCAAA
GAAACGCCCCTATTCGTGACACCTCCAGGCTTTCATCCTAACTCTACTTTTTTTGGTATGAAGAAAGAACTTGAA
GTGCTGCACAGCCGGCTATTCAAAGCCAAGGCGCGTCCGGAAAAGACAATGGCCGTACTAATCTCCGGCGTTCCA
GGCTCTGGAAAGACACATCTAGCGCGGCAGTACGTTTTTACTCAACGTGACTGCTACCCAGGTGGCATATTTTGG
ATTGACGCCAAGTCCCGTGAATCGACGTACAAGTGTTTTTGGGAGATTGCACAAGCAGCCACGCTAATTGAGCAG
AAGGTGACCGTGAACCCCGAGTACCACGAGACTGAAAAGTACGTGAATGCAGTCCGCCTCTGGCTGCAGACACGC
AAAGATTGGCTCCTCATCTTCGACGGCGTCACCTTCGAGCGCGATGACGATATCAGTAAGTTCAGAGAGGTTCTG
CCCTGGAGCAAACAGTGCAGTATCATATACACCTCGGTCGATAAAACGCTGCGCAAAAAGCGACGACTGTACGAG
CCATATTGCCTGATGATCTCACGGTTGCAAGTGGGTGACGCTTGCAAGCTTCTGTTCAAGGATCTTGGAATTACA
CGACCGACACCCGAGCAAATGGCCAAGGCTACCCAGATAGTTGAGAACTACGAATGTCTACCTCTGGCAATTCAT
GCAATTGGGCACCGTCTCAATGCAACGGGTAAACCGATTGAAAAGTATCATGTCAGATCTCAGGTGACAGACAAG
AAGCTTGCAGAACCTTTCTTGAGTATCATGAACGACTTGTTTCGGTTGCAGCAAAAGCAGGCGCTGCACTTGATT
AATCTTCTCTCGTTTCTTGGCCACCAGGTGCCAGTGGGCCTTCTGAACCTCGGTGGAGCGGCTATGGCCGCCGTG
AACTTAGAGATCCAGACCAGCGCCCAATCCGGAGAAGATCCTGATCTCGATACTACTCTTGGAACCCTCATTCAC
TATGGTTTGATTGAACGGATTTCAGATGCCGATCTCTTTCAGCACAGATCGTCTTTGCGTCACTCTGATAGCGAT
CCTAAGGACGTGAAGCTTGTTTCCGAACTCTCAGATTCCCTGACAGAGAGCAGTCAAGAAGGATTTTTCTCCATA
TACCGGGGTGGATCTGTGGTTGATGTAGTCAAGATCCATAGTGTCGTGCAGGGGTTCTGTCGTGATGAGCTCCGA
ATCAAGGACGAGGAGAACAAAGGCATCATGAGCAAGAATGACCCTGGTTTTTTCGATACTTGGCTGATTGTTGCC
ACTCGTTTTCTCATTACGTCCTACGATGCCGCTATGGGACGAATGGCTCATTACGAAGACTGTGGCCTTGTCCGG
GACTACCGAGAGTACGAAACTCACGCTTCACGACTGCTTGAGCTCTTTCCAAAGAAAGCAGCCATCAATCTCCAT
CCACTGATCGTTCGTGAAACACGAGAGACCTTGCGACGATTGATGAAGATAATAAGCAAAGAGATAGATAATGTG
TCTCCAAGCTCCTCGCAATACTCTACACGGAATCAAAAGTCGGTTTTCGACAGGTCAAGCAGCTCGTCATCATCC
CTCCGCGATTCATCCGACGAAGGCCCATCGCGCCGCTCTACCTTCAACTGGAGTGATCTTGAATCATCTCGAGCG
GGAACGCCTGAGCATATAGCTACACCACCTCCCCAGTTCAGATTAGAGCTTTTCCCTCCACATATCTTCAGGCAA
GCTGGATACGAATCTGAAGAAGGTTATGAAACAGACGGGGAAGTTAAGACAGCCATGTCGCAAACGAGCCAAGCC
ACGGAGAAACCTAACAAGACACCTCCCTCATTCAGTCCTCCACAAACAGCCGGCTTAGCGGAGTGGCATGTGGTC
AATCGACACTCAAAGCAAAGGTCAAATCAAGATACTCAAACAAAGAGGCGCAGCAAAGGCCCTCGTCGCTTTGTA
GATACCAAGTTAAATACCCCACTGGTCAGACTGTCCTCCATCCAAGGAAAGGGATCATCAAGCCGCACAACATCT
GCCGAAACGGGGGGCACTTTGATGTCAGCTTCGGAGGCTGAACAAGCACTTGCTGCAGTGCGTCGGTCTAGCAAT
TCCCAAGCGTCCGCTGACGTTCCGCAGCCTGCAATCACCTCTCCACCATCCAACAAAGAGAATATGCCAACGTAT
GCGAATGTGGCAACTCGACGGAGGTTAGAAGTAAAGTCTACGATGAAGCGCCCGTCATCAGTTCCCATTTCGCAG
GCTTCAGCCTATTTGAATGATGACTTGCAGATAAAACATTCCACTGACTCGCTCGACAGCCAAGCGGGCTACGCC
TTTACATCTCCGCTATACCATGATGTGTCTGAAGATTTGATCACCGAGCCCCTGAGTCGGTCAACCTACAGTGAG
CCTGAGTTCAATAAGTTCAGTCACCATCACGGGGCAGATTTACATACCACGCCTGGATCCCAGGCTCCCTCTCGG
CGTGGCTCAGTGCCACATCTGGAGGTGCCACGAAATCTATCTGCAAGCGTGCCATTCCTCTTTCCATATCCACCG
CCGCCCCCATACGATGAGAACAACTCCGTTTCTCTTCCAAACCGCAGAAAATCGTCTCAATTAACACCAGGCTCA
ATAAATTCCCCAGGGGCTCTTTCTTCCATTGCTCATCCATCCGCAATTATGCCCAGAGCTTTGCCATCATATAAT
GCCAAAGTACACGTGGGGTCAGCCCCAGAGCGCTCAGTTCCCGAGCCGATGTCGCGTGACTCTTCCGCCTACTCT
TATCAATCGTGGGCCACAGAACCCGTGCGATATCCCCCGAGTTTCCAACAGGCCGAGATGATCCTAAATCCACCA
TTGAGCATGCAAAATCAACAGCAAATGTTGACCGGGACTAGCTGGACCGAATTACCTCTGGCAGGCAATGCTGCT
CTCCAGCCAGATCCCATCTCCCTCAGCCCGCCCGCGTCATCGCACGGACACCTCGGCTCCATGGAAGAGCGACTG
GAGCATCCTGACTCGGGCTGGAACCAGGAGATCGAGCCAGTGCAGTTTTTGCATTTTGGCGAGCACCGTGTTGAT
GTACAAGATGCACGACTCCGACTCCATGAATCGGCTCGGCTGTTGCATCCGCGGCCCCACCAGTATCAGCCGTAC
CATCCCAACTTGTCGGGTCCTTTGATTCAGCATGAGGGACAAATCTATGCGCCGGCTTCGCGACTGGAGGCATAC
GGGACTCGTGCGCGTAGTGGAAGCTCCCCTGTGCAACCTGACTATGCTGGTTTGGATGTGCGGTTCTCATAA
Gene >Pro_DTO377G3_2|g2250.t1
ATGAGAATCATCACAACTTTTAGAGACACCCTGGCTGACTTCATCCTAGAACAATCCATATTATCTCTACCGCGT
GGCCCTGCGACAGAAGGCCGGAATTCCCCAGTATCTGATCTGGGGAACAGTGGAATTTTCCAACTCTGCGCCAAA
GAAACGCCCCTATTCGTGACACCTCCAGGCTTTCATCCTAACTCTACTTTTTTTGGTATGAAGAAAGAACTTGAA
GTGCTGCACAGCCGGCTATTCAAAGCCAAGGCGCGTCCGGAAAAGACAATGGCCGTACTAATCTCCGGCGTTCCA
GGCTCTGGAAAGACACATCTAGCGCGGCAGTACGTTTTTACTCAACGTGACTGCTACCCAGGTGGCATATTTTGG
ATTGACGCCAAGTCCCGTGAATCGACGTACAAGTGTTTTTGGGAGATTGCACAAGCAGCCACGCTAATTGAGCAG
AAGGTGACCGTGAACCCCGAGTACCACGAGACTGAAAAGTACGTGAATGCAGTCCGCCTCTGGCTGCAGACACGC
AAAGATTGGCTCCTCATCTTCGACGGCGTCACCTTCGAGCGCGATGACGATATCAGTAAGTTCAGAGAGGTTCTG
CCCTGGAGCAAACAGTGCAGTATCATATACACCTCGGTCGATAAAACGCTGCGCAAAAAGCGACGACTGTACGAG
CCATATTGCCTGATGATCTCACGGTTGCAAGTGGGTGACGCTTGCAAGCTTCTGTTCAAGGATCTTGGAATTACA
CGACCGACACCCGAGCAAATGGCCAAGGCTACCCAGATAGTTGAGAACTACGAATGTCTACCTCTGGCAATTCAT
GCAATTGGGCACCGTCTCAATGCAACGGGTAAACCGATTGAAAAGTATCATGTCAGATCTCAGGTGACAGACAAG
AAGCTTGCAGAACCTTTCTTGAGTATCATGAACGACTTGTTTCGGTTGCAGCAAAAGCAGGCGCTGCACTTGATT
AATCTTCTCTCGTTTCTTGGCCACCAGGTGCCAGTGGGCCTTCTGAACCTCGGTGGAGCGGCTATGGCCGCCGTG
AACTTAGAGATCCAGACCAGCGCCCAATCCGGAGAAGATCCTGATCTCGATACTACTCTTGGAACCCTCATTCAC
TATGGTTTGATTGAACGGATTTCAGATGCCGATCTCTTTCAGCACAGATCGTCTTTGCGTCACTCTGATAGCGAT
CCTAAGGACGTGAAGCTTGTTTCCGAACTCTCAGATTCCCTGACAGAGAGCAGTCAAGAAGGATTTTTCTCCATA
TACCGGGGTGGATCTGTGGTTGATGTAGTCAAGATCCATAGTGTCGTGCAGGGGTTCTGTCGTGATGAGCTCCGA
ATCAAGGACGAGGAGAACAAAGGCATCATGAGCAAGAATGACCCTGGTTTTTTCGATACTTGGCTGATTGTTGCC
ACTCGTTTTCTCATTACGTCCTACGATGCCGCTATGGGACGAATGGCTCATTACGAAGACTGTGGCCTTGTCCGG
GACTACCGAGAGTACGAAACTCACGCTTCACGACTGCTTGAGCTCTTTCCAAAGAAAGCAGCCATCAATCTCCAT
CCACTGATCGTTCGTGAAACACGAGAGACCTTGCGACGATTGATGAAGATAATAAGCAAAGAGATAGATAATGTG
TCTCCAAGCTCCTCGCAATACTCTACACGGAATCAAAAGTCGGTTTTCGACAGGTCAAGCAGCTCGTCATCATCC
CTCCGCGATTCATCCGACGAAGGCCCATCGCGCCGCTCTACCTTCAACTGGAGTGATCTTGAATCATCTCGAGCG
GGAACGCCTGAGCATATAGCTACACCACCTCCCCAGTTCAGATTAGAGCTTTTCCCTCCACATATCTTCAGGCAA
GCTGGATACGAATCTGAAGAAGGTTATGAAACAGACGGGGAAGTTAAGACAGCCATGTCGCAAACGAGCCAAGCC
ACGGAGAAACCTAACAAGACACCTCCCTCATTCAGTCCTCCACAAACAGCCGGCTTAGCGGAGTGGCATGTGGTC
AATCGACACTCAAAGCAAAGGTCAAATCAAGATACTCAAACAAAGAGGCGCAGCAAAGGCCCTCGTCGCTTTGTA
GATACCAAGTTAAATACCCCACTGGTCAGACTGTCCTCCATCCAAGGAAAGGGATCATCAAGCCGCACAACATCT
GCCGAAACGGGGGGCACTTTGATGTCAGCTTCGGAGGCTGAACAAGCACTTGCTGCAGTGCGTCGGTCTAGCAAT
TCCCAAGCGTCCGCTGACGTTCCGCAGCCTGCAATCACCTCTCCACCATCCAACAAAGAGAATATGCCAACGTAT
GCGAATGTGGCAACTCGACGGAGGTTAGAAGTAAAGTCTACGATGAAGCGCCCGTCATCAGTTCCCATTTCGCAG
GCTTCAGCCTATTTGAATGATGACTTGCAGATAAAACATTCCACTGACTCGCTCGACAGCCAAGCGGGCTACGCC
TTTACATCTCCGCTATACCATGATGTGTCTGAAGATTTGATCACCGAGCCCCTGAGTCGGTCAACCTACAGTGAG
CCTGAGTTCAATAAGTTCAGTCACCATCACGGGGCAGATTTACATACCACGCCTGGATCCCAGGCTCCCTCTCGG
CGTGGCTCAGTGCCACATCTGGAGGTGCCACGAAATCTATCTGCAAGCGTGCCATTCCTCTTTCCATATCCACCG
CCGCCCCCATACGATGAGAACAACTCCGTTTCTCTTCCAAACCGCAGAAAATCGTCTCAATTAACACCAGGCTCA
ATAAATTCCCCAGGGGCTCTTTCTTCCATTGCTCATCCATCCGCAATTATGCCCAGAGCTTTGCCATCATATAAT
GCCAAAGTACACGTGGGGTCAGCCCCAGAGCGCTCAGTTCCCGAGCCGATGTCGCGTGACTCTTCCGCCTACTCT
TATCAATCGTGGGCCACAGAACCCGTGCGATATCCCCCGAGTTTCCAACAGGCCGAGATGATCCTAAATCCACCA
TTGAGCATGCAAAATCAACAGCAAATGTTGACCGGGACTAGCTGGACCGAATTACCTCTGGCAGGCAATGCTGCT
CTCCAGCCAGATCCCATCTCCCTCAGCCCGCCCGCGTCATCGCACGGACACCTCGGCTCCATGGAAGAGCGACTG
GAGCATCCTGACTCGGGCTGGAACCAGGAGATCGAGCCAGTGCAGTTTTTGCATTTTGGCGAGCACCGTGTTGAT
GTACAAGATGCACGACTCCGACTCCATGAATCGGCTCGGCTGTTGCATCCGCGGCCCCACCAGTATCAGCCGTAC
CATCCCAACTTGTCGGGTCCTTTGATTCAGCATGAGGGACAAATCTATGCGCCGGCTTCGCGACTGGAGGCATAC
GGGACTCGTGCGCGTAGTGGAAGCTCCCCTGTGCAACCTGACTATGCTGGTTTGGATGTGCGGTTCTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail