Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2249.t1
Gene name
Locationscaffold_02:2045979..2047964
Strand+
Gene length (bp)1985
Transcript length (bp)1677
Coding sequence length (bp)1677
Protein length (aa) 559

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin 9.8E-102 39 487

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22
2 73 95 22
3 132 154 22
4 169 191 22
5 204 226 22
6 241 263 22
7 275 297 22
8 332 354 22
9 375 397 22
10 402 421 19
11 449 470 21
12 480 502 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 5.21 1.76 8.66
5d_25C Five days - 25 degrees Celsius 5.33 1.72 8.94
7d_25C Seven days - 25 degrees Celsius 7.26 2.65 11.87
10d_25C Ten days - 25 degrees Celsius 2.88 0.50 5.27
7d_15C Seven days - 15 degrees Celsius 10.59 3.89 17.29
7d_30C Seven days - 30 degrees Celsius 7.63 2.73 12.53

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.969100 no
3d_25C 7d_25C 0.406784 no
3d_25C 7d_15C 0.034125 yes
3d_25C 7d_30C 0.323344 no
3d_25C 10d_25C 0.164348 no
5d_25C 7d_25C 0.467872 no
5d_25C 7d_15C 0.050710 no
5d_25C 7d_30C 0.384597 no
5d_25C 10d_25C 0.160342 no
7d_25C 7d_15C 0.330530 no
7d_25C 7d_30C 0.930059 no
7d_25C 10d_25C 0.024892 yes
7d_15C 7d_30C 0.412713 no
7d_15C 10d_25C 0.001278 yes
7d_30C 10d_25C 0.017204 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2249.t1
MSKLSRLHELLLVKRTQRDGIERPVDMLDNDSIRPTSVKDRTWSQLTYIMFWFSATANVSNLYTASTGMAMGLTM
WEAIGCSFGGQILAGALMAVNGRAGAMYRIPFPVLCRSSFGHWGALWPTFNRAVMSIVWNGVNTVQGGQCLYVFL
HAIFPSIENIPDKMGSKSALTSAQMMCFFIYWLVNCAFLVVPVPRMKSLVYIKVVVYFGAAFAMLGWTVSLAGGS
LKTINAPSEIKGTEKSYLIFKFLFLGLASCGTFISNASDLQRYATKPNDVLIGQIISFPLSNFLVAILGNLIASA
SKAIFGKLIWNPLQFLDKLMEGERYTSGNRTACAFISLAFVYSTVFSAIFENSIPAGNDIAALLPKYISIKRGFF
ICAVLSYAICPWYLLASASIFITFLSSYQIFLSAITGILICDYYLIRRGLLNIPALYISSPSPYRYFHGFNPRAF
LTYVIAIAPNFYGFLFQMGVKAPLGIKRFYYIAYPTGLIIAFVVYYLSCLAFPPPDMKQASGWMEPKDFVEDHDA
SGSDESTIDAVDPDFAEKGAVAVARPAGEKGSF*
Coding >Pro_DTO377G3_2|g2249.t1
ATGTCCAAACTATCGCGACTCCATGAGCTCTTACTAGTGAAAAGAACCCAGCGGGATGGCATCGAGCGCCCCGTT
GATATGCTGGATAATGACTCTATCCGACCGACTTCAGTAAAGGATCGAACATGGTCCCAACTCACCTATATCATG
TTCTGGTTCTCGGCGACTGCGAACGTCAGCAATCTGTACACAGCGTCCACGGGAATGGCCATGGGATTGACCATG
TGGGAAGCGATCGGATGCTCGTTCGGTGGTCAGATCCTCGCCGGTGCCTTGATGGCTGTGAACGGCCGTGCTGGC
GCCATGTACCGCATTCCGTTCCCCGTTCTATGTCGCTCCAGCTTTGGGCATTGGGGAGCACTGTGGCCGACTTTC
AATCGGGCGGTCATGTCAATTGTGTGGAACGGTGTCAATACCGTTCAAGGAGGACAATGTTTATATGTCTTTCTC
CATGCGATTTTCCCTTCTATTGAAAACATCCCGGATAAGATGGGATCCAAGTCGGCTTTGACTTCAGCACAAATG
ATGTGTTTCTTCATCTATTGGCTTGTCAATTGCGCATTCTTAGTGGTGCCTGTACCAAGAATGAAATCCCTGGTC
TACATCAAAGTCGTCGTTTACTTCGGCGCAGCATTTGCTATGCTGGGATGGACTGTGTCTCTCGCCGGTGGTTCT
TTGAAGACAATCAATGCGCCCTCGGAGATAAAGGGCACGGAAAAAAGCTATCTCATTTTTAAGTTCCTCTTCTTG
GGACTCGCAAGTTGTGGAACTTTCATCTCCAATGCGTCCGATCTCCAGCGATACGCTACAAAGCCCAACGACGTC
CTCATCGGCCAGATTATCAGCTTTCCACTGTCGAACTTCCTAGTTGCCATTCTAGGTAACCTTATCGCGTCAGCT
AGCAAAGCTATCTTTGGAAAGCTCATCTGGAACCCGCTGCAGTTCTTGGACAAATTGATGGAAGGAGAGCGATAC
ACCTCTGGCAACCGCACGGCCTGTGCTTTTATTTCTCTGGCATTCGTGTATTCGACTGTCTTCTCTGCCATTTTT
GAGAACTCTATCCCTGCGGGTAACGATATTGCAGCCCTACTACCAAAATACATTTCAATAAAACGAGGATTCTTC
ATCTGCGCCGTCCTCTCCTACGCAATCTGCCCCTGGTATCTCCTCGCATCAGCCTCAATTTTCATCACATTCCTC
TCCTCCTACCAAATCTTTCTCTCAGCAATCACCGGCATTCTCATCTGCGACTACTACCTAATCCGCCGAGGGCTA
CTCAACATTCCCGCCCTATACATCTCAAGCCCAAGTCCGTACCGATACTTCCACGGATTCAACCCGCGAGCATTC
TTGACCTACGTTATTGCCATTGCGCCAAACTTCTACGGGTTCCTTTTCCAGATGGGCGTCAAGGCGCCTCTAGGT
ATCAAGCGATTCTACTATATCGCTTACCCTACCGGTCTCATAATCGCTTTTGTTGTTTATTACCTGTCGTGTCTG
GCCTTCCCCCCGCCTGATATGAAGCAGGCGTCTGGCTGGATGGAGCCTAAGGACTTCGTGGAGGATCATGATGCT
TCTGGAAGTGATGAGTCTACTATTGATGCCGTTGACCCTGACTTCGCGGAGAAGGGGGCTGTTGCGGTTGCTAGA
CCAGCTGGCGAAAAGGGTTCGTTCTGA
Transcript >Pro_DTO377G3_2|g2249.t1
ATGTCCAAACTATCGCGACTCCATGAGCTCTTACTAGTGAAAAGAACCCAGCGGGATGGCATCGAGCGCCCCGTT
GATATGCTGGATAATGACTCTATCCGACCGACTTCAGTAAAGGATCGAACATGGTCCCAACTCACCTATATCATG
TTCTGGTTCTCGGCGACTGCGAACGTCAGCAATCTGTACACAGCGTCCACGGGAATGGCCATGGGATTGACCATG
TGGGAAGCGATCGGATGCTCGTTCGGTGGTCAGATCCTCGCCGGTGCCTTGATGGCTGTGAACGGCCGTGCTGGC
GCCATGTACCGCATTCCGTTCCCCGTTCTATGTCGCTCCAGCTTTGGGCATTGGGGAGCACTGTGGCCGACTTTC
AATCGGGCGGTCATGTCAATTGTGTGGAACGGTGTCAATACCGTTCAAGGAGGACAATGTTTATATGTCTTTCTC
CATGCGATTTTCCCTTCTATTGAAAACATCCCGGATAAGATGGGATCCAAGTCGGCTTTGACTTCAGCACAAATG
ATGTGTTTCTTCATCTATTGGCTTGTCAATTGCGCATTCTTAGTGGTGCCTGTACCAAGAATGAAATCCCTGGTC
TACATCAAAGTCGTCGTTTACTTCGGCGCAGCATTTGCTATGCTGGGATGGACTGTGTCTCTCGCCGGTGGTTCT
TTGAAGACAATCAATGCGCCCTCGGAGATAAAGGGCACGGAAAAAAGCTATCTCATTTTTAAGTTCCTCTTCTTG
GGACTCGCAAGTTGTGGAACTTTCATCTCCAATGCGTCCGATCTCCAGCGATACGCTACAAAGCCCAACGACGTC
CTCATCGGCCAGATTATCAGCTTTCCACTGTCGAACTTCCTAGTTGCCATTCTAGGTAACCTTATCGCGTCAGCT
AGCAAAGCTATCTTTGGAAAGCTCATCTGGAACCCGCTGCAGTTCTTGGACAAATTGATGGAAGGAGAGCGATAC
ACCTCTGGCAACCGCACGGCCTGTGCTTTTATTTCTCTGGCATTCGTGTATTCGACTGTCTTCTCTGCCATTTTT
GAGAACTCTATCCCTGCGGGTAACGATATTGCAGCCCTACTACCAAAATACATTTCAATAAAACGAGGATTCTTC
ATCTGCGCCGTCCTCTCCTACGCAATCTGCCCCTGGTATCTCCTCGCATCAGCCTCAATTTTCATCACATTCCTC
TCCTCCTACCAAATCTTTCTCTCAGCAATCACCGGCATTCTCATCTGCGACTACTACCTAATCCGCCGAGGGCTA
CTCAACATTCCCGCCCTATACATCTCAAGCCCAAGTCCGTACCGATACTTCCACGGATTCAACCCGCGAGCATTC
TTGACCTACGTTATTGCCATTGCGCCAAACTTCTACGGGTTCCTTTTCCAGATGGGCGTCAAGGCGCCTCTAGGT
ATCAAGCGATTCTACTATATCGCTTACCCTACCGGTCTCATAATCGCTTTTGTTGTTTATTACCTGTCGTGTCTG
GCCTTCCCCCCGCCTGATATGAAGCAGGCGTCTGGCTGGATGGAGCCTAAGGACTTCGTGGAGGATCATGATGCT
TCTGGAAGTGATGAGTCTACTATTGATGCCGTTGACCCTGACTTCGCGGAGAAGGGGGCTGTTGCGGTTGCTAGA
CCAGCTGGCGAAAAGGGTTCGTTCTGA
Gene >Pro_DTO377G3_2|g2249.t1
ATGTCCAAACTATCGCGACTCCATGAGCTCTTACTAGTGAAAAGAACCCAGCGGGATGGCATCGAGCGCCCCGTT
GATATGCTGGATAATGACTCTATCCGACCGACTTCAGTAAAGGATCGAACATGGTCCCAACTCACCTATATCATG
TTCTGGTTCTCGGCGACTGCGAACGTCAGCAATCTGTACACAGCGTCCACGGGAATGGCCATGGGATTGACCATG
TGGGAAGCGATCGGATGCTCGTTCGGTGGTCAGATCCTCGCCGGTGCCTTGATGGCTGTGAACGGCCGTGCTGGC
GCCATGTACCGCATTCCGTTCCCCGTTCTATGTCGCTCCAGCTTTGGGCATTGGGGAGCACTGTGGCCGACTTTC
AATCGGGCGGTCATGTCAATTGTGTGGAACGGTGTCAATACCGTTCAAGGAGGACAATGTTTATAGTGAGTCTTT
TTTTTTCTTAGTCTCGTTCTTTCCCTGGTGAGGGAAGCACTGACCGTGTGGTTGTTGACTTTCGTTTCTAGTGTC
TTTCTCCATGCGATTTTCCCTTCTATTGAAAACATCCCGGATAAGATGGGATCCAAGTCGGCTTTGACTTCAGCA
CAAATGATGTGTTTCTTCATCTATTGGTACAGTGGCTAGTATCTCAATGCTTGATCTACTGCTAACTAGTCTCCA
CAGGCTTGTCAATTGCGCATTCTTAGTGGTGCCTGTACCAAGAATGAAATCCCTGGTCTACATCAAAGTCGTCGT
TTACTTCGGCGCAGCATTTGCTATGCTGGGATGGACTGTGTCTCTCGCCGGTGGTTCTTTGAAGACAATCAATGC
GCCCTCGGAGATAAAGGGCACGGAAAAAAGCTATCTCATTTTTAAGTTCCTCTTCTTGGGACTCGCAAGTTGTGG
AACTTTCATCTCCAATGCGTCCGATCTCCAGCGATACGCTACAAAGCCCAACGACGTCCTCATCGGCCAGATTAT
CAGCTTTCCACTGTCGAACTTCCTAGTTGCCATTCTAGGTAACCTTATCGCGTCAGCTAGCAAAGCTATCTTTGG
AAAGGTTTGTCATATCAAAAGCCTTGTTGAAAGAACTAAGGACTGACGAAATCCTCTAGCTCATCTGGAACCCGC
TGCAGTTCTTGGACAAATTGATGGAAGGAGAGCGATACACCTCTGGCAACCGCACGGCCTGTGCTTTTATTTCTC
TGGCATTCGTGTATTCGACTGTCTTCTCTGCCATTTTTGAGAACTCTATCCCGTAAGGATCACCTTCTCCCACAT
TTCTATGCCATATACTAACAACCTTCAGTGCGGGTAACGATATTGCAGCCCTACTACCAAAATACATTTCAATAA
AACGAGGATTCTTCATCTGCGCCGGTAAGAAAAGAACCAAAGACTCAAAAAATTCCATTGCCTCGACCCAAAACT
AACAACCAAACCTACTAGTCCTCTCCTACGCAATCTGCCCCTGGTATCTCCTCGCATCAGCCTCAATTTTCATCA
CATTCCTCTCCTCCTACCAAATCTTTCTCTCAGCAATCACCGGCATTCTCATCTGCGACTACTACCTAATCCGCC
GAGGGCTACTCAACATTCCCGCCCTATACATCTCAAGCCCAAGTCCGTACCGATACTTCCACGGATTCAACCCGC
GAGCATTCTTGACCTACGTTATTGCCATTGCGCCAAACTTCTACGGGTTCCTTTTCCAGATGGGCGTCAAGGCGC
CTCTAGGTATCAAGCGATTCTACTATATCGCTTACCCTACCGGTCTCATAATCGCTTTTGTTGTTTATTACCTGT
CGTGTCTGGCCTTCCCCCCGCCTGATATGAAGCAGGCGTCTGGCTGGATGGAGCCTAAGGACTTCGTGGAGGATC
ATGATGCTTCTGGAAGTGATGAGTCTACTATTGATGCCGTTGACCCTGACTTCGCGGAGAAGGGGGCTGTTGCGG
TTGCTAGACCAGCTGGCGAAAAGGGTTCGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail