Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2245.t1
Gene namelea
Locationscaffold_02:2037874..2038290
Strand-
Gene length (bp)416
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 9663.89 5100.44 14227.3
5d_25C Five days - 25 degrees Celsius 13575.40 6723.39 20427.4
7d_25C Seven days - 25 degrees Celsius 14116.00 6947.18 21284.9
10d_25C Ten days - 25 degrees Celsius 21471.70 10098.10 32845.4
7d_15C Seven days - 15 degrees Celsius 15775.90 7445.43 24106.3
7d_30C Seven days - 30 degrees Celsius 10585.40 5284.93 15886.0

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.241986 no
3d_25C 7d_25C 0.179077 no
3d_25C 7d_15C 0.073459 no
3d_25C 7d_30C 0.816664 no
3d_25C 10d_25C 0.002297 yes
5d_25C 7d_25C 0.931745 no
5d_25C 7d_15C 0.683256 no
5d_25C 7d_30C 0.445245 no
5d_25C 10d_25C 0.116411 no
7d_25C 7d_15C 0.774093 no
7d_25C 7d_30C 0.356337 no
7d_25C 10d_25C 0.152072 no
7d_15C 7d_30C 0.174115 no
7d_15C 10d_25C 0.333095 no
7d_30C 10d_25C 0.007779 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2245.t1
MSAARFAPLLRTRVAVQTAPGFQAIRSISATAPCNKGPVDATKETLKKADRTVSDAAVKGINTGEKAAHKLKDAV
SGGAKQAKEKGEEVKGEAAQYADKGKSKAEEALRK*
Coding >Pro_DTO377G3_2|g2245.t1
ATGTCTGCAGCACGATTCGCTCCTCTCCTCAGAACCCGGGTGGCGGTACAGACCGCACCTGGCTTCCAGGCCATT
CGCTCCATCTCAGCTACGGCACCATGCAACAAGGGACCTGTTGATGCGACAAAGGAGACATTGAAGAAAGCCGAC
CGGACTGTTTCTGATGCAGCAGTCAAGGGCATCAACACGGGTGAGAAAGCCGCCCACAAGCTTAAGGATGCTGTT
AGCGGCGGGGCTAAGCAAGCAAAGGAAAAGGGAGAAGAGGTGAAGGGCGAGGCGGCCCAGTATGCAGACAAGGGC
AAGAGCAAGGCAGAAGAAGCACTGAGAAAGTAG
Transcript >Pro_DTO377G3_2|g2245.t1
ATGTCTGCAGCACGATTCGCTCCTCTCCTCAGAACCCGGGTGGCGGTACAGACCGCACCTGGCTTCCAGGCCATT
CGCTCCATCTCAGCTACGGCACCATGCAACAAGGGACCTGTTGATGCGACAAAGGAGACATTGAAGAAAGCCGAC
CGGACTGTTTCTGATGCAGCAGTCAAGGGCATCAACACGGGTGAGAAAGCCGCCCACAAGCTTAAGGATGCTGTT
AGCGGCGGGGCTAAGCAAGCAAAGGAAAAGGGAGAAGAGGTGAAGGGCGAGGCGGCCCAGTATGCAGACAAGGGC
AAGAGCAAGGCAGAAGAAGCACTGAGAAAGTAG
Gene >Pro_DTO377G3_2|g2245.t1
ATGTCTGCAGCACGATTCGCTCCTCTCCTCAGAACCCGGGTGGCGGTACAGACCGCACCTGGCTTCCAGGCCATT
CGCTCCATCTCAGCTACGGCACCATGCAACAAGGGACCTGTTGATGCGACAAAGGAGACATTGAAGAAAGCCGAC
CGGACTGTTTCTGATGCAGCAGTCAAGGGCATCAACACGGGTGGTATGTCTTCAATGTGATCTCATTGATCTATA
TGACTTTGATTCAATGTGCAGAGACTGATGCTAACATGAATTTGCCCACAGAGAAAGCCGCCCACAAGCTTAAGG
ATGCTGTTAGCGGCGGGGCTAAGCAAGCAAAGGAAAAGGGAGAAGAGGTGAAGGGCGAGGCGGCCCAGTATGCAG
ACAAGGGCAAGAGCAAGGCAGAAGAAGCACTGAGAAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail