Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2223.t1
Gene name
Locationscaffold_02:1976498..1979398
Strand-
Gene length (bp)2900
Transcript length (bp)2850
Coding sequence length (bp)2850
Protein length (aa) 950

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11489 Aim21 Altered inheritance of mitochondria protein 21 9.4E-241 28 801

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 129.30 76.77 181.83
5d_25C Five days - 25 degrees Celsius 138.54 81.27 195.80
7d_25C Seven days - 25 degrees Celsius 119.45 71.08 167.82
10d_25C Ten days - 25 degrees Celsius 113.17 67.49 158.86
7d_15C Seven days - 15 degrees Celsius 172.34 98.03 246.65
7d_30C Seven days - 30 degrees Celsius 98.60 59.25 137.94

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.830039 no
3d_25C 7d_25C 0.794538 no
3d_25C 7d_15C 0.246414 no
3d_25C 7d_30C 0.250173 no
3d_25C 10d_25C 0.636175 no
5d_25C 7d_25C 0.603461 no
5d_25C 7d_15C 0.419820 no
5d_25C 7d_30C 0.143642 no
5d_25C 10d_25C 0.445245 no
7d_25C 7d_15C 0.112289 no
7d_25C 7d_30C 0.456403 no
7d_25C 10d_25C 0.873742 no
7d_15C 7d_30C 0.009124 yes
7d_15C 10d_25C 0.071533 no
7d_30C 10d_25C 0.623202 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2223.t1
MSQPAPVIPPRPARSPKPPAASSSSEMPKIPPRPGNRRSDRSASPMRDSYAPSPFNEWTGPSMSRTVSNDLPPRP
PSVTIPSLGEEGIEYADLDPGNMSDTHHQTPAETRNVGSDLKIHAPRPSLPISSAEARVRGVTRTDSRQAAAAGL
GRGVSPAREELERSSRSLHSRTSGSRTGSTASNERRHSAHMGDEQGFRVPMYPNAGDVQAPSPSPYLEQGSQRSS
RNHNRTRSARDSSLPPGSYGLHGHGVQHPDKFEKAWYEKHPDEFVKEEGKYGPGVGTPRPDWAMSSDDLNKIVRS
SAQTGSGLGTSPSIVGTPEEEVGYIASDEYIQQIASPPPDGRFESQPTVESPLRQMSFPSEATQKQTTARPLHQR
RSSSHGHRDGGVIHVDDPMHPLHHPDGFAATPALEENEPTYENAVEDDEPILAADEVRPESAYLHPAVSPSFDRR
PSFEDDGRSRTPSSHSRSNSRSNSRSASVQGQLTRFDSREDTYTPLEDVEEYEPLFPEEDAKKGKPVSAADRFKK
RPDTLKHRFPSQDIWEDTPNSLQLQATVTTPDLPKRDSAEVFETPEQEAKRKMQNAKVDSHRVAALILEGENGRD
KTPARPDTLKQRFPSRDIWEDAPDSQQLVTTIEPAKEELKSPEVPSRPGIPPRPQRQPQSTSPTEKRQPPSIPGR
PKPQVPTRPAKPSSQAAGTTAEASKDAPAVKAKPAIPGRPGGSKIAAMKAGFLTDLNSRLQLGPQQPKPQEKEPE
VPVEKQPLSDARKGRARGPARRKPAVEKTSPTLPTIPEIKITEALNIWQVDQDGKVVVGTSKKEEKSAVAVKEPS
VTAERPMAPPIAKNTAGESVDPTPESPVLEDMTSPRTTTADVYPIQTPAETSKSAGSSPIATESADKQEGKDDMD
VTKSAEPAAVPAGSPESVSVPTNLDDALEEMAASADGKRESDGSIHPEL*
Coding >Pro_DTO377G3_2|g2223.t1
ATGTCCCAACCTGCTCCGGTCATTCCTCCTCGACCGGCCCGATCTCCAAAACCACCGGCAGCGTCATCGTCGTCA
GAAATGCCCAAGATACCGCCGCGCCCGGGCAATCGCCGCAGTGATCGTTCGGCTTCGCCCATGCGTGATAGCTAT
GCACCTTCGCCGTTCAATGAATGGACCGGTCCTAGCATGAGTCGCACCGTTTCAAATGATTTGCCTCCACGTCCT
CCCAGCGTCACGATACCGTCCCTCGGCGAGGAGGGTATTGAATATGCGGATCTCGACCCAGGAAACATGTCGGAT
ACCCATCACCAGACACCTGCGGAGACTCGCAATGTTGGCAGTGATCTTAAGATCCATGCACCGAGACCTTCGTTG
CCGATATCAAGTGCGGAAGCAAGAGTCCGAGGTGTCACCCGGACTGATTCCCGCCAGGCTGCTGCGGCAGGACTA
GGCCGTGGTGTTTCGCCTGCTCGCGAGGAACTAGAACGTTCAAGTCGTTCACTGCATTCCCGAACGAGTGGTTCA
CGCACCGGATCAACTGCATCCAATGAGCGCCGACACTCTGCCCACATGGGAGATGAGCAGGGGTTCCGCGTGCCC
ATGTATCCAAATGCCGGTGACGTCCAGGCACCATCCCCCAGCCCGTACCTCGAACAAGGCTCGCAGCGGTCCAGC
CGTAACCACAACCGCACTCGTAGTGCTCGGGACTCTTCACTGCCCCCTGGTAGCTATGGATTGCATGGACATGGT
GTTCAGCATCCCGATAAGTTTGAGAAGGCTTGGTATGAAAAGCATCCCGATGAATTCGTGAAGGAAGAAGGAAAA
TATGGCCCTGGTGTCGGCACTCCGCGTCCCGATTGGGCAATGAGCAGCGATGATCTGAACAAGATTGTTCGAAGC
TCGGCCCAGACTGGTTCCGGTCTTGGTACTTCCCCATCCATCGTGGGTACCCCCGAAGAAGAGGTCGGATATATA
GCGTCCGACGAGTACATACAGCAAATTGCTTCTCCCCCTCCCGACGGTCGATTCGAAAGCCAACCGACTGTTGAG
TCGCCACTTCGACAGATGAGTTTCCCTTCAGAAGCAACGCAGAAGCAAACTACCGCAAGGCCACTGCATCAACGT
AGATCCAGTTCGCATGGTCATCGTGATGGTGGCGTGATCCACGTGGATGATCCGATGCATCCTTTGCACCATCCG
GATGGATTCGCCGCCACCCCGGCGCTGGAAGAGAATGAGCCGACATATGAGAACGCCGTGGAGGACGATGAGCCA
ATTTTGGCTGCTGATGAAGTGCGCCCCGAGTCGGCGTACTTGCATCCCGCCGTCTCGCCGTCATTTGATCGTCGA
CCAAGCTTCGAGGATGATGGCCGCAGTCGAACCCCTAGTTCCCACAGTCGTTCCAACAGTCGTTCCAACAGTCGG
TCGGCAAGTGTGCAAGGCCAACTAACCCGCTTTGACTCGCGCGAGGATACGTATACACCTCTTGAAGACGTCGAG
GAGTATGAACCGTTGTTCCCTGAAGAGGATGCTAAGAAAGGGAAACCCGTGTCAGCTGCGGATCGCTTCAAGAAA
AGGCCTGACACACTCAAGCACAGATTCCCTAGCCAGGATATCTGGGAGGATACCCCGAACAGTCTGCAGCTTCAG
GCCACCGTCACCACCCCAGATCTGCCTAAGCGAGACTCTGCCGAAGTCTTCGAAACACCCGAGCAAGAGGCCAAA
CGCAAGATGCAGAACGCCAAAGTCGACTCTCATCGGGTGGCCGCCCTCATCCTGGAAGGCGAGAACGGCAGGGAT
AAGACTCCCGCGCGACCCGACACTTTGAAACAGCGTTTCCCCAGTAGAGATATTTGGGAAGATGCCCCTGATAGT
CAACAGCTGGTGACCACAATTGAGCCTGCAAAAGAAGAATTGAAAAGTCCGGAAGTACCTTCCAGGCCTGGAATT
CCCCCGCGCCCGCAGAGACAGCCTCAGTCTACCTCACCGACCGAAAAGCGCCAACCACCATCAATTCCAGGCAGA
CCCAAGCCTCAGGTCCCTACCCGTCCTGCTAAGCCCAGTTCCCAGGCCGCAGGAACCACCGCTGAAGCCTCGAAA
GATGCTCCTGCAGTTAAGGCCAAGCCCGCAATTCCTGGTCGTCCAGGCGGGAGCAAAATTGCAGCCATGAAGGCG
GGCTTCCTCACTGATCTGAATTCACGTCTGCAGCTGGGTCCGCAGCAGCCAAAGCCTCAGGAAAAGGAGCCCGAG
GTGCCGGTTGAGAAGCAGCCTCTCAGCGATGCTCGTAAGGGAAGAGCCCGTGGACCAGCACGACGCAAGCCAGCC
GTCGAGAAAACCAGTCCCACGCTCCCCACTATCCCAGAGATCAAGATCACAGAAGCTTTGAATATCTGGCAGGTC
GACCAGGATGGAAAGGTTGTTGTTGGAACCAGTAAGAAGGAAGAGAAGTCTGCCGTTGCAGTGAAGGAACCGTCG
GTGACTGCTGAACGCCCAATGGCCCCTCCAATTGCCAAGAATACCGCCGGTGAATCTGTAGACCCAACACCTGAA
TCTCCGGTTTTAGAGGACATGACCTCGCCCAGGACCACAACAGCGGATGTCTACCCTATACAGACCCCAGCAGAG
ACCTCGAAATCGGCTGGATCGTCTCCCATAGCAACCGAATCGGCAGATAAGCAGGAGGGCAAGGACGACATGGAC
GTGACAAAGTCCGCTGAACCTGCAGCTGTTCCCGCGGGGTCGCCTGAATCTGTCTCAGTCCCAACTAATCTGGAT
GATGCCCTGGAAGAAATGGCTGCATCAGCTGACGGAAAGAGGGAGTCTGACGGTAGCATTCACCCTGAACTGTAG
Transcript >Pro_DTO377G3_2|g2223.t1
ATGTCCCAACCTGCTCCGGTCATTCCTCCTCGACCGGCCCGATCTCCAAAACCACCGGCAGCGTCATCGTCGTCA
GAAATGCCCAAGATACCGCCGCGCCCGGGCAATCGCCGCAGTGATCGTTCGGCTTCGCCCATGCGTGATAGCTAT
GCACCTTCGCCGTTCAATGAATGGACCGGTCCTAGCATGAGTCGCACCGTTTCAAATGATTTGCCTCCACGTCCT
CCCAGCGTCACGATACCGTCCCTCGGCGAGGAGGGTATTGAATATGCGGATCTCGACCCAGGAAACATGTCGGAT
ACCCATCACCAGACACCTGCGGAGACTCGCAATGTTGGCAGTGATCTTAAGATCCATGCACCGAGACCTTCGTTG
CCGATATCAAGTGCGGAAGCAAGAGTCCGAGGTGTCACCCGGACTGATTCCCGCCAGGCTGCTGCGGCAGGACTA
GGCCGTGGTGTTTCGCCTGCTCGCGAGGAACTAGAACGTTCAAGTCGTTCACTGCATTCCCGAACGAGTGGTTCA
CGCACCGGATCAACTGCATCCAATGAGCGCCGACACTCTGCCCACATGGGAGATGAGCAGGGGTTCCGCGTGCCC
ATGTATCCAAATGCCGGTGACGTCCAGGCACCATCCCCCAGCCCGTACCTCGAACAAGGCTCGCAGCGGTCCAGC
CGTAACCACAACCGCACTCGTAGTGCTCGGGACTCTTCACTGCCCCCTGGTAGCTATGGATTGCATGGACATGGT
GTTCAGCATCCCGATAAGTTTGAGAAGGCTTGGTATGAAAAGCATCCCGATGAATTCGTGAAGGAAGAAGGAAAA
TATGGCCCTGGTGTCGGCACTCCGCGTCCCGATTGGGCAATGAGCAGCGATGATCTGAACAAGATTGTTCGAAGC
TCGGCCCAGACTGGTTCCGGTCTTGGTACTTCCCCATCCATCGTGGGTACCCCCGAAGAAGAGGTCGGATATATA
GCGTCCGACGAGTACATACAGCAAATTGCTTCTCCCCCTCCCGACGGTCGATTCGAAAGCCAACCGACTGTTGAG
TCGCCACTTCGACAGATGAGTTTCCCTTCAGAAGCAACGCAGAAGCAAACTACCGCAAGGCCACTGCATCAACGT
AGATCCAGTTCGCATGGTCATCGTGATGGTGGCGTGATCCACGTGGATGATCCGATGCATCCTTTGCACCATCCG
GATGGATTCGCCGCCACCCCGGCGCTGGAAGAGAATGAGCCGACATATGAGAACGCCGTGGAGGACGATGAGCCA
ATTTTGGCTGCTGATGAAGTGCGCCCCGAGTCGGCGTACTTGCATCCCGCCGTCTCGCCGTCATTTGATCGTCGA
CCAAGCTTCGAGGATGATGGCCGCAGTCGAACCCCTAGTTCCCACAGTCGTTCCAACAGTCGTTCCAACAGTCGG
TCGGCAAGTGTGCAAGGCCAACTAACCCGCTTTGACTCGCGCGAGGATACGTATACACCTCTTGAAGACGTCGAG
GAGTATGAACCGTTGTTCCCTGAAGAGGATGCTAAGAAAGGGAAACCCGTGTCAGCTGCGGATCGCTTCAAGAAA
AGGCCTGACACACTCAAGCACAGATTCCCTAGCCAGGATATCTGGGAGGATACCCCGAACAGTCTGCAGCTTCAG
GCCACCGTCACCACCCCAGATCTGCCTAAGCGAGACTCTGCCGAAGTCTTCGAAACACCCGAGCAAGAGGCCAAA
CGCAAGATGCAGAACGCCAAAGTCGACTCTCATCGGGTGGCCGCCCTCATCCTGGAAGGCGAGAACGGCAGGGAT
AAGACTCCCGCGCGACCCGACACTTTGAAACAGCGTTTCCCCAGTAGAGATATTTGGGAAGATGCCCCTGATAGT
CAACAGCTGGTGACCACAATTGAGCCTGCAAAAGAAGAATTGAAAAGTCCGGAAGTACCTTCCAGGCCTGGAATT
CCCCCGCGCCCGCAGAGACAGCCTCAGTCTACCTCACCGACCGAAAAGCGCCAACCACCATCAATTCCAGGCAGA
CCCAAGCCTCAGGTCCCTACCCGTCCTGCTAAGCCCAGTTCCCAGGCCGCAGGAACCACCGCTGAAGCCTCGAAA
GATGCTCCTGCAGTTAAGGCCAAGCCCGCAATTCCTGGTCGTCCAGGCGGGAGCAAAATTGCAGCCATGAAGGCG
GGCTTCCTCACTGATCTGAATTCACGTCTGCAGCTGGGTCCGCAGCAGCCAAAGCCTCAGGAAAAGGAGCCCGAG
GTGCCGGTTGAGAAGCAGCCTCTCAGCGATGCTCGTAAGGGAAGAGCCCGTGGACCAGCACGACGCAAGCCAGCC
GTCGAGAAAACCAGTCCCACGCTCCCCACTATCCCAGAGATCAAGATCACAGAAGCTTTGAATATCTGGCAGGTC
GACCAGGATGGAAAGGTTGTTGTTGGAACCAGTAAGAAGGAAGAGAAGTCTGCCGTTGCAGTGAAGGAACCGTCG
GTGACTGCTGAACGCCCAATGGCCCCTCCAATTGCCAAGAATACCGCCGGTGAATCTGTAGACCCAACACCTGAA
TCTCCGGTTTTAGAGGACATGACCTCGCCCAGGACCACAACAGCGGATGTCTACCCTATACAGACCCCAGCAGAG
ACCTCGAAATCGGCTGGATCGTCTCCCATAGCAACCGAATCGGCAGATAAGCAGGAGGGCAAGGACGACATGGAC
GTGACAAAGTCCGCTGAACCTGCAGCTGTTCCCGCGGGGTCGCCTGAATCTGTCTCAGTCCCAACTAATCTGGAT
GATGCCCTGGAAGAAATGGCTGCATCAGCTGACGGAAAGAGGGAGTCTGACGGTAGCATTCACCCTGAACTGTAG
Gene >Pro_DTO377G3_2|g2223.t1
ATGTCCCAACCTGCTCCGGTCATTCCTCCTCGACCGGCCCGATCTCCAAAACCACCGGCAGCGTCATCGTCGTCA
GAAATGCCCAAGATACCGCCGCGCCCGGGCAATCGCCGCAGTGATCGTTCGGCTTCGCCCATGCGTGATAGCTAT
GCACCTTCGCCGTTCAATGAATGGACCGGTCCTAGCATGAGTCGCACCGTTTCAAATGATTTGCCTCCACGTCCT
CCCAGCGTCACGATACCGTCCCTCGGCGAGGAGGGTATTGAATATGCGGATCTCGACCCAGGAAACATGTCGGAT
ACCCATCACCAGACACCTGCGGAGACTCGCAATGTTGGCAGTGATCTTAAGATCCATGCACCGAGACCTTCGTTG
CCGATATCAAGTGCGGAAGCAAGAGTCCGAGGTGTCACCCGGACTGATTCCCGCCAGGCTGCTGCGGCAGGACTA
GGCCGTGGTGTTTCGCCTGCTCGCGAGGAACTAGAACGTTCAAGTCGTTCACTGCATTCCCGAACGAGTGGTTCA
CGCACCGGATCAACTGCATCCAATGAGCGCCGACACTCTGCCCACATGGGAGATGAGCAGGGGTTCCGCGTGCCC
ATGTATCCAAATGCCGGTGACGTCCAGGCACCATCCCCCAGCCCGTACCTCGAACAAGGCTCGCAGCGGTCCAGC
CGTAACCACAACCGCACTCGTAGTGCTCGGGACTCTTCACTGCCCCCTGGTAGCTATGGATTGCATGGACATGGT
GTTCAGCATCCCGATAAGTTTGAGAAGGCTTGGTATGAAAAGCATCCCGATGAATTCGTGAAGGAAGAAGGAAAA
TATGGCCCTGGTGTCGGCACTCCGCGTCCCGATTGGGCAATGAGCAGCGATGATCTGAACAAGATTGTTCGAAGC
TCGGCCCAGACTGGTTCCGGTCTTGGTGAGTATTTGAAGCAATTGTGCTGCCGATTGAAAGCTAACTGTAGCTAG
GTACTTCCCCATCCATCGTGGGTACCCCCGAAGAAGAGGTCGGATATATAGCGTCCGACGAGTACATACAGCAAA
TTGCTTCTCCCCCTCCCGACGGTCGATTCGAAAGCCAACCGACTGTTGAGTCGCCACTTCGACAGATGAGTTTCC
CTTCAGAAGCAACGCAGAAGCAAACTACCGCAAGGCCACTGCATCAACGTAGATCCAGTTCGCATGGTCATCGTG
ATGGTGGCGTGATCCACGTGGATGATCCGATGCATCCTTTGCACCATCCGGATGGATTCGCCGCCACCCCGGCGC
TGGAAGAGAATGAGCCGACATATGAGAACGCCGTGGAGGACGATGAGCCAATTTTGGCTGCTGATGAAGTGCGCC
CCGAGTCGGCGTACTTGCATCCCGCCGTCTCGCCGTCATTTGATCGTCGACCAAGCTTCGAGGATGATGGCCGCA
GTCGAACCCCTAGTTCCCACAGTCGTTCCAACAGTCGTTCCAACAGTCGGTCGGCAAGTGTGCAAGGCCAACTAA
CCCGCTTTGACTCGCGCGAGGATACGTATACACCTCTTGAAGACGTCGAGGAGTATGAACCGTTGTTCCCTGAAG
AGGATGCTAAGAAAGGGAAACCCGTGTCAGCTGCGGATCGCTTCAAGAAAAGGCCTGACACACTCAAGCACAGAT
TCCCTAGCCAGGATATCTGGGAGGATACCCCGAACAGTCTGCAGCTTCAGGCCACCGTCACCACCCCAGATCTGC
CTAAGCGAGACTCTGCCGAAGTCTTCGAAACACCCGAGCAAGAGGCCAAACGCAAGATGCAGAACGCCAAAGTCG
ACTCTCATCGGGTGGCCGCCCTCATCCTGGAAGGCGAGAACGGCAGGGATAAGACTCCCGCGCGACCCGACACTT
TGAAACAGCGTTTCCCCAGTAGAGATATTTGGGAAGATGCCCCTGATAGTCAACAGCTGGTGACCACAATTGAGC
CTGCAAAAGAAGAATTGAAAAGTCCGGAAGTACCTTCCAGGCCTGGAATTCCCCCGCGCCCGCAGAGACAGCCTC
AGTCTACCTCACCGACCGAAAAGCGCCAACCACCATCAATTCCAGGCAGACCCAAGCCTCAGGTCCCTACCCGTC
CTGCTAAGCCCAGTTCCCAGGCCGCAGGAACCACCGCTGAAGCCTCGAAAGATGCTCCTGCAGTTAAGGCCAAGC
CCGCAATTCCTGGTCGTCCAGGCGGGAGCAAAATTGCAGCCATGAAGGCGGGCTTCCTCACTGATCTGAATTCAC
GTCTGCAGCTGGGTCCGCAGCAGCCAAAGCCTCAGGAAAAGGAGCCCGAGGTGCCGGTTGAGAAGCAGCCTCTCA
GCGATGCTCGTAAGGGAAGAGCCCGTGGACCAGCACGACGCAAGCCAGCCGTCGAGAAAACCAGTCCCACGCTCC
CCACTATCCCAGAGATCAAGATCACAGAAGCTTTGAATATCTGGCAGGTCGACCAGGATGGAAAGGTTGTTGTTG
GAACCAGTAAGAAGGAAGAGAAGTCTGCCGTTGCAGTGAAGGAACCGTCGGTGACTGCTGAACGCCCAATGGCCC
CTCCAATTGCCAAGAATACCGCCGGTGAATCTGTAGACCCAACACCTGAATCTCCGGTTTTAGAGGACATGACCT
CGCCCAGGACCACAACAGCGGATGTCTACCCTATACAGACCCCAGCAGAGACCTCGAAATCGGCTGGATCGTCTC
CCATAGCAACCGAATCGGCAGATAAGCAGGAGGGCAAGGACGACATGGACGTGACAAAGTCCGCTGAACCTGCAG
CTGTTCCCGCGGGGTCGCCTGAATCTGTCTCAGTCCCAACTAATCTGGATGATGCCCTGGAAGAAATGGCTGCAT
CAGCTGACGGAAAGAGGGAGTCTGACGGTAGCATTCACCCTGAACTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail