Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2216.t1
Gene name
Locationscaffold_02:1952552..1954927
Strand+
Gene length (bp)2375
Transcript length (bp)2085
Coding sequence length (bp)2085
Protein length (aa) 695

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 5.3E-54 92 254
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 5.2E-46 499 646
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 9.4E-38 291 436

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0000287 magnesium ion binding Yes
GO:0030976 thiamine pyrophosphate binding Yes
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0050662 coenzyme binding No
GO:0048037 cofactor binding No
GO:0019842 vitamin binding No
GO:1901681 sulfur compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2216.t1
MMPLRPSKSALRAFHLQKQLAGRRPFSTSFVASAASPHRSSVQKRAQSTATASNPESRPVPSPSFNQEPHRNEIS
PLQHRQLPELDDSMVGMSGGEIFHEMMLRQGVKHIFGYPGGAILPVFDAIYNSKHFDFLLPKHEQGAGHMAEGYA
RASGKPGVVLVTSGPGATNVITPMQDAMSDGTPMVVFCGQVPTSAIGTDSFQEADVIGISRACTKWNVMVKSVGE
LPRRIQEAFEIATSGRPGPVLVDLPKDVTAGILRNPIPMHSTIPSLPSAATVAAREMSRKQLESTINRVAHLVNI
AKKPVLYVGQGLLARPDGPMILKEFADKACIPVTTTLQGLGGFDELDPKALHMLGMHGSAYANMAMQEADLIIAV
GARFDDRVTLSIPKFAPQAKLAATEGRGGIVHFEIMPKNINKVVQANEAVEGDCADNLRLLLPHVKAVSERPEWF
EQINDWKKRFPLTLYDRQTEDGPIKPQAVIEKLSELTADRKEKTIITTGVGQHQMWTAQHFRWRHPRTMITSGGL
GTMGFGLPAALGAKVARPDCLVIDIDGDASFNMTLTELSTAAQFNIGVKVLLINNEEQGMVTQWQNLFYEDRYSH
THQQNPDFVPLAKAMRVAADKCFKPSELEEKLKWLIDHDGPALLEVITDRKVPVLPMVPSGRGLHEFLVYDEAKD
LERKELMRQRNVDFHVRKE*
Coding >Pro_DTO377G3_2|g2216.t1
ATGATGCCTTTAAGACCCTCAAAAAGTGCTCTGCGAGCATTCCACCTCCAGAAACAGCTTGCTGGACGTCGACCT
TTTTCTACCTCATTTGTGGCTTCGGCCGCTTCGCCCCACCGCTCCTCTGTCCAAAAGCGTGCTCAGAGCACAGCT
ACGGCTTCAAATCCGGAGTCCAGACCCGTGCCCAGTCCGTCATTCAACCAGGAACCCCATCGCAATGAGATTTCT
CCCTTGCAACACCGCCAGCTCCCCGAGCTCGATGACTCAATGGTTGGAATGAGTGGTGGCGAGATCTTCCACGAG
ATGATGCTTCGCCAGGGTGTGAAGCACATCTTCGGTTACCCCGGTGGTGCTATTCTCCCCGTTTTCGATGCTATC
TACAACTCCAAGCACTTCGATTTCCTTCTTCCCAAGCACGAACAGGGTGCTGGTCACATGGCCGAGGGTTATGCC
CGTGCCTCTGGCAAGCCCGGTGTCGTTCTCGTTACTTCTGGCCCTGGTGCTACCAACGTTATTACTCCCATGCAA
GATGCTATGTCAGATGGTACTCCGATGGTTGTTTTCTGTGGTCAGGTCCCTACCAGCGCTATTGGAACCGATTCC
TTCCAAGAAGCCGATGTGATCGGTATCTCCCGTGCCTGCACCAAGTGGAACGTGATGGTCAAGTCCGTTGGTGAG
CTACCTCGCCGCATCCAGGAAGCTTTCGAGATCGCCACGAGTGGTCGTCCAGGTCCCGTCCTGGTTGACCTACCC
AAGGATGTCACTGCTGGCATTCTCCGCAACCCTATTCCCATGCACAGCACTATCCCTTCGCTCCCTAGCGCAGCT
ACCGTGGCGGCCCGTGAAATGAGCCGGAAGCAGCTTGAGAGCACCATCAACCGTGTTGCTCACCTCGTTAACATT
GCCAAAAAGCCTGTCCTCTACGTTGGACAGGGTCTCCTTGCTCGCCCCGATGGCCCCATGATTCTCAAGGAGTTT
GCCGATAAGGCATGCATTCCGGTCACCACCACCCTGCAGGGCCTTGGTGGATTTGACGAGTTGGATCCCAAGGCT
CTCCACATGTTGGGTATGCACGGATCCGCTTACGCCAACATGGCTATGCAGGAGGCTGATCTGATCATTGCTGTT
GGTGCCCGTTTCGATGACCGTGTGACTCTCAGCATCCCCAAGTTTGCGCCTCAAGCCAAGCTTGCTGCTACTGAA
GGCCGCGGTGGTATCGTGCATTTCGAGATCATGCCGAAGAACATCAACAAGGTTGTCCAGGCCAATGAGGCCGTG
GAGGGTGACTGTGCCGACAACCTCCGTCTTCTTTTGCCCCATGTCAAGGCTGTTTCCGAGCGACCTGAATGGTTC
GAGCAAATCAACGACTGGAAGAAGCGCTTCCCCCTGACACTCTATGACCGTCAGACCGAGGATGGTCCTATCAAG
CCCCAGGCTGTTATCGAGAAGCTTAGCGAACTCACCGCCGACCGGAAGGAAAAGACCATTATCACCACTGGTGTC
GGACAGCACCAGATGTGGACTGCCCAGCACTTCCGCTGGCGTCACCCTCGTACCATGATCACCTCCGGTGGTCTC
GGCACTATGGGCTTCGGTCTCCCCGCCGCTCTTGGAGCCAAGGTGGCCCGTCCGGACTGCCTCGTCATCGATATC
GATGGTGATGCTTCTTTCAACATGACTCTTACTGAGCTTTCCACCGCTGCTCAGTTCAACATTGGTGTCAAGGTC
CTTCTGATCAACAACGAGGAGCAGGGTATGGTCACTCAATGGCAAAACCTCTTCTACGAGGATCGTTACTCCCAC
ACTCACCAGCAGAACCCCGACTTCGTCCCACTTGCAAAGGCTATGCGCGTCGCTGCCGACAAGTGCTTCAAACCC
TCCGAACTTGAGGAGAAGTTGAAGTGGCTGATTGATCACGATGGCCCTGCCCTCCTGGAGGTCATCACTGACCGT
AAAGTGCCCGTTCTTCCTATGGTGCCTTCTGGCCGCGGTCTTCACGAGTTCTTGGTCTACGATGAAGCCAAGGAT
TTGGAGCGCAAGGAGCTGATGCGCCAGCGTAATGTCGACTTCCATGTCCGGAAAGAGTAG
Transcript >Pro_DTO377G3_2|g2216.t1
ATGATGCCTTTAAGACCCTCAAAAAGTGCTCTGCGAGCATTCCACCTCCAGAAACAGCTTGCTGGACGTCGACCT
TTTTCTACCTCATTTGTGGCTTCGGCCGCTTCGCCCCACCGCTCCTCTGTCCAAAAGCGTGCTCAGAGCACAGCT
ACGGCTTCAAATCCGGAGTCCAGACCCGTGCCCAGTCCGTCATTCAACCAGGAACCCCATCGCAATGAGATTTCT
CCCTTGCAACACCGCCAGCTCCCCGAGCTCGATGACTCAATGGTTGGAATGAGTGGTGGCGAGATCTTCCACGAG
ATGATGCTTCGCCAGGGTGTGAAGCACATCTTCGGTTACCCCGGTGGTGCTATTCTCCCCGTTTTCGATGCTATC
TACAACTCCAAGCACTTCGATTTCCTTCTTCCCAAGCACGAACAGGGTGCTGGTCACATGGCCGAGGGTTATGCC
CGTGCCTCTGGCAAGCCCGGTGTCGTTCTCGTTACTTCTGGCCCTGGTGCTACCAACGTTATTACTCCCATGCAA
GATGCTATGTCAGATGGTACTCCGATGGTTGTTTTCTGTGGTCAGGTCCCTACCAGCGCTATTGGAACCGATTCC
TTCCAAGAAGCCGATGTGATCGGTATCTCCCGTGCCTGCACCAAGTGGAACGTGATGGTCAAGTCCGTTGGTGAG
CTACCTCGCCGCATCCAGGAAGCTTTCGAGATCGCCACGAGTGGTCGTCCAGGTCCCGTCCTGGTTGACCTACCC
AAGGATGTCACTGCTGGCATTCTCCGCAACCCTATTCCCATGCACAGCACTATCCCTTCGCTCCCTAGCGCAGCT
ACCGTGGCGGCCCGTGAAATGAGCCGGAAGCAGCTTGAGAGCACCATCAACCGTGTTGCTCACCTCGTTAACATT
GCCAAAAAGCCTGTCCTCTACGTTGGACAGGGTCTCCTTGCTCGCCCCGATGGCCCCATGATTCTCAAGGAGTTT
GCCGATAAGGCATGCATTCCGGTCACCACCACCCTGCAGGGCCTTGGTGGATTTGACGAGTTGGATCCCAAGGCT
CTCCACATGTTGGGTATGCACGGATCCGCTTACGCCAACATGGCTATGCAGGAGGCTGATCTGATCATTGCTGTT
GGTGCCCGTTTCGATGACCGTGTGACTCTCAGCATCCCCAAGTTTGCGCCTCAAGCCAAGCTTGCTGCTACTGAA
GGCCGCGGTGGTATCGTGCATTTCGAGATCATGCCGAAGAACATCAACAAGGTTGTCCAGGCCAATGAGGCCGTG
GAGGGTGACTGTGCCGACAACCTCCGTCTTCTTTTGCCCCATGTCAAGGCTGTTTCCGAGCGACCTGAATGGTTC
GAGCAAATCAACGACTGGAAGAAGCGCTTCCCCCTGACACTCTATGACCGTCAGACCGAGGATGGTCCTATCAAG
CCCCAGGCTGTTATCGAGAAGCTTAGCGAACTCACCGCCGACCGGAAGGAAAAGACCATTATCACCACTGGTGTC
GGACAGCACCAGATGTGGACTGCCCAGCACTTCCGCTGGCGTCACCCTCGTACCATGATCACCTCCGGTGGTCTC
GGCACTATGGGCTTCGGTCTCCCCGCCGCTCTTGGAGCCAAGGTGGCCCGTCCGGACTGCCTCGTCATCGATATC
GATGGTGATGCTTCTTTCAACATGACTCTTACTGAGCTTTCCACCGCTGCTCAGTTCAACATTGGTGTCAAGGTC
CTTCTGATCAACAACGAGGAGCAGGGTATGGTCACTCAATGGCAAAACCTCTTCTACGAGGATCGTTACTCCCAC
ACTCACCAGCAGAACCCCGACTTCGTCCCACTTGCAAAGGCTATGCGCGTCGCTGCCGACAAGTGCTTCAAACCC
TCCGAACTTGAGGAGAAGTTGAAGTGGCTGATTGATCACGATGGCCCTGCCCTCCTGGAGGTCATCACTGACCGT
AAAGTGCCCGTTCTTCCTATGGTGCCTTCTGGCCGCGGTCTTCACGAGTTCTTGGTCTACGATGAAGCCAAGGAT
TTGGAGCGCAAGGAGCTGATGCGCCAGCGTAATGTCGACTTCCATGTCCGGAAAGAGTAG
Gene >Pro_DTO377G3_2|g2216.t1
ATGATGCCTTTAAGACCCTCAAAAAGTGCTCTGCGAGCATTCCACCTCCAGAAACAGCTTGCTGGACGTCGACCT
TTTTCTACCTCATTTGTGGCTTCGGCCGCTTCGCCCCACCGCTCCTCTGTCCAAAAGCGTGCTCAGAGCACAGCT
ACGGCTTCAAATCCGTGAGTTTTTTTGTGCCTCCTATGATCAAAATGTAATTGCAGTTTGATTCTGAACTTTTTA
ATCGTCAGGGAGTCCAGACCCGTGCCCAGTCCGTCATTCAACCAGGAACCCCATCGCAATGAGATTTCTCCCTTG
CAACACCGCCAGCTCCCCGAGCTCGATGACTCGTATGTTACCCTGAGGAAATTTTGGACACATGAAAACTAATTA
GTTGGTATAAAGAATGGTTGGAATGAGTGGTGGCGAGATCTTCCACGAGATGATGCTTCGCCAGGGTGTGAAGCA
CATCTGTGAGTACTTCATGCTTGATATTGCACAATTGGCCGGTTCTAATATTTGATGTGCAGTCGGTTACCCCGG
TGGTGCTATTCTCCCCGTTTTCGATGCTATCTACAACTCCAAGCACTTCGATTTCCTTCTTCCCAAGCACGAACA
GGGTGCTGGTCACATGGCCGAGGGTTATGCCCGTGCCTCTGGCAAGCCCGGTGTCGTTCTCGTTACTTCTGGCCC
TGGTGCTACCAACGTTATTACTCCCATGCAAGATGCTATGTCAGATGGTACTCCGATGGTTGTTTTCTGTGGTCA
GGTCCCTACCAGCGCTATTGGAACCGATTCCTTCCAAGAAGCCGATGTGATCGGTATCTCCCGTGCCTGCACCAA
GTGGAACGTGATGGTCAAGTCCGTTGGTGAGCTACCTCGCCGCATCCAGGAAGCTTTCGAGATCGCCACGAGTGG
TCGTCCAGGTCCCGTCCTGGTTGACCTACCCAAGGATGTCACTGCTGGCATTCTCCGCAACCCTATTCCCATGCA
CAGCACTATCCCTTCGCTCCCTAGCGCAGCTACCGTGGCGGCCCGTGAAATGAGCCGGAAGCAGCTTGAGAGCAC
CATCAACCGTGTTGCTCACCTCGTTAACATTGCCAAAAAGCCTGTCCTCTACGTTGGACAGGGTCTCCTTGCTCG
CCCCGATGGCCCCATGATTCTCAAGGAGTTTGCCGATAAGGCATGCATTCCGGTCACCACCACCCTGCAGGGCCT
TGGTGGATTTGACGAGTTGGATCCCAAGGCTCTCCACATGTTGGGTATGCACGGATCCGCTTACGCCAACATGGC
TATGCAGGAGGCTGATCTGATCATTGCTGTTGGTGCCCGTTTCGATGACCGTGTGACTCTCAGCATCCCCAAGTT
TGCGCCTCAAGCCAAGCTTGCTGCTACTGAAGGCCGCGGTGGTATCGTGCATTTCGAGATCATGCCGAAGAACAT
CAACAAGGTTGTCCAGGCCAATGAGGCCGTGGAGGGTGACTGTGCCGACAACCTCCGTCTTCTTTTGCCCCATGT
CAAGGCTGTTTCCGAGCGACCTGAATGGTTCGAGCAAATCAACGACTGGAAGAAGCGCTTCCCCCTGACACTCTA
TGACCGTCAGACCGAGGATGGTCCTATCAAGCCCCAGGCTGTTATCGAGAAGCTTAGCGAACTCACCGCCGACCG
GAAGGAAAAGACCATTATCACCACTGGTGTCGGACAGCACCAGATGTGGACTGCCCAGCACTTCCGCTGGCGTCA
CCCTCGTACCATGATCACCTCCGGTGGTCTCGGCACTATGGGCTTCGGTCTCCCCGCCGCTCTTGGAGCCAAGGT
GGCCCGTCCGGACTGCCTCGTCATCGATATCGATGGTGATGCTTCTTTCAACATGACTCTTACTGAGCTTTCCAC
CGCTGCTCAGTTCAACATTGGTGTCAAGGTCCTTCTGATCAACAACGAGGAGCAGGGTATGGTCACTCAATGGTA
AGCTGTTCCCTCCGGTCTTCCTAGTATATCTGGCTTACTTTTTTGTTACAGGCAAAACCTCTTCTACGAGGATCG
TTACTCCCACACTCACCAGCAGAACCCCGACTTCGTCCCACTTGCAAAGGCTATGCGCGTCGCTGCCGACAAGTG
CTTCAAACCCTCCGAACTTGAGGAGAAGTTGAAGTGGCTGATTGATCACGATGGCCCTGCCCTCCTGGAGGTCAT
CACTGACCGTAAAGTGCCCGTTCTTCCTATGGTGCCTTCTGGCCGCGGTCTTCACGAGTTCTTGGTCTACGATGA
AGGTACGCAAACCCCTGGCTAGTGATTTAGGAAACAGCATTAACTCATTTATTACAGCCAAGGATTTGGAGCGCA
AGGAGCTGATGCGCCAGCGTAATGTCGACTTCCATGTCCGGAAAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail