Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2211.t1
Gene name
Locationscaffold_02:1940816..1941603
Strand-
Gene length (bp)787
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08651 DASH_Duo1 DASH complex subunit Duo1 4.2E-31 69 140

GO

GO Term Description Terminal node
GO:0042729 DASH complex Yes
GO:0000278 mitotic cell cycle Yes
GO:0072686 mitotic spindle Yes
GO:0043228 non-membrane-bounded organelle No
GO:0007049 cell cycle No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0009987 cellular process No
GO:0005819 spindle No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0140513 nuclear protein-containing complex No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2211.t1
MAFRTTAEEMERLQLSDDDTEDLWNSPSKRVTRKKINPRTSDEKPTLEPRASHDGEDPLFDHQQSRETALRTELQ
GVRNINEVIEGLLASLDSAKGNMETVSQTVTSASTLLNTWTRILSQTEHNQRLILNPDWQGATQDVIDIENQAIQ
RQQAAERREQALQQQREAAARKAEEIEKRRAQVTRGTRGTRGTTRGTVRTTGLGRTPSVSTSRTATRGSTTTTQR
PASGIARGSGIARGRGRV*
Coding >Pro_DTO377G3_2|g2211.t1
ATGGCTTTCCGCACCACAGCAGAAGAAATGGAGAGGCTTCAGCTGTCTGATGATGACACAGAGGACCTCTGGAAT
TCACCATCCAAGAGAGTGACCCGCAAAAAGATCAACCCAAGAACCTCCGATGAGAAACCTACACTAGAACCTCGA
GCTTCCCATGATGGCGAGGATCCTCTCTTTGATCATCAACAGTCTCGAGAGACTGCGCTCCGGACAGAATTACAA
GGTGTGCGGAATATCAACGAAGTAATAGAAGGGCTTCTGGCAAGTTTGGATTCCGCCAAAGGGAACATGGAGACG
GTCTCACAAACCGTTACGTCGGCCTCGACACTCCTCAACACGTGGACTCGCATTCTCTCCCAAACTGAGCATAAT
CAGCGACTGATCCTCAACCCCGATTGGCAAGGCGCTACTCAGGATGTGATCGATATCGAGAACCAAGCGATCCAA
AGACAGCAAGCGGCAGAAAGACGCGAACAGGCACTTCAGCAGCAGCGAGAAGCAGCAGCGAGAAAGGCCGAGGAA
ATCGAAAAACGACGCGCACAGGTCACTCGGGGTACTCGAGGCACCCGTGGAACTACGAGGGGTACAGTTCGAACT
ACTGGATTAGGAAGAACGCCCAGTGTCAGCACAAGCCGCACGGCAACACGAGGGTCTACGACAACAACCCAACGG
CCAGCCAGCGGGATTGCACGAGGTAGCGGGATTGCTCGCGGTCGGGGGAGAGTCTAG
Transcript >Pro_DTO377G3_2|g2211.t1
ATGGCTTTCCGCACCACAGCAGAAGAAATGGAGAGGCTTCAGCTGTCTGATGATGACACAGAGGACCTCTGGAAT
TCACCATCCAAGAGAGTGACCCGCAAAAAGATCAACCCAAGAACCTCCGATGAGAAACCTACACTAGAACCTCGA
GCTTCCCATGATGGCGAGGATCCTCTCTTTGATCATCAACAGTCTCGAGAGACTGCGCTCCGGACAGAATTACAA
GGTGTGCGGAATATCAACGAAGTAATAGAAGGGCTTCTGGCAAGTTTGGATTCCGCCAAAGGGAACATGGAGACG
GTCTCACAAACCGTTACGTCGGCCTCGACACTCCTCAACACGTGGACTCGCATTCTCTCCCAAACTGAGCATAAT
CAGCGACTGATCCTCAACCCCGATTGGCAAGGCGCTACTCAGGATGTGATCGATATCGAGAACCAAGCGATCCAA
AGACAGCAAGCGGCAGAAAGACGCGAACAGGCACTTCAGCAGCAGCGAGAAGCAGCAGCGAGAAAGGCCGAGGAA
ATCGAAAAACGACGCGCACAGGTCACTCGGGGTACTCGAGGCACCCGTGGAACTACGAGGGGTACAGTTCGAACT
ACTGGATTAGGAAGAACGCCCAGTGTCAGCACAAGCCGCACGGCAACACGAGGGTCTACGACAACAACCCAACGG
CCAGCCAGCGGGATTGCACGAGGTAGCGGGATTGCTCGCGGTCGGGGGAGAGTCTAG
Gene >Pro_DTO377G3_2|g2211.t1
ATGGCTTTCCGCACCACAGCAGAAGAAATGGAGAGGCTTCAGCTGTCTGATGATGACACAGAGGACCTCTGGAAT
TCACCATCCAAGAGAGTGACCCGCAAAAAGATCAACCCAAGAACCTCCGATGAGAAACCTACACTAGAACCTCGA
GCTTCCCATGATGGCGAGGATCCTCTCTTTGATCATCAACAGTCTCGAGAGACTGCGCTCCGGACAGAATTACAA
GGTGTGCGGAATATCAACGAAGTAATAGAAGGGCTTCTGGCAAGTTTGGATTCCGCCAAAGGGAACATGGAGGTA
ATATATTCTTCTCATAATGCACGGTCAATACTTTGGCTAATTATCCGTATAGACGGTCTCACAAACCGTTACGTC
GGCCTCGACACTCCTCAACACGTGGACTCGCATTCTCTCCCAAACTGAGCATAATCAGCGACTGATCCTCAACCC
CGATTGGCAAGGCGCTACTCAGGATGTGATCGATATCGAGAACCAAGCGATCCAAAGACAGCAAGCGGCAGAAAG
ACGCGAACAGGCACTTCAGCAGCAGCGAGAAGCAGCAGCGAGAAAGGCCGAGGAAATCGAAAAACGACGCGCACA
GGTCACTCGGGGTACTCGAGGCACCCGTGGAACTACGAGGGGTACAGTTCGAACTACTGGATTAGGAAGAACGCC
CAGTGTCAGCACAAGCCGCACGGCAACACGAGGGTCTACGACAACAACCCAACGGCCAGCCAGCGGGATTGCACG
AGGTAGCGGGATTGCTCGCGGTCGGGGGAGAGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail