Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g221.t1
Gene name
Locationscaffold_01:575454..576484
Strand+
Gene length (bp)1030
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15916 DUF4743 Domain of unknown function (DUF4743) 2.4E-13 26 135
PF00293 NUDIX NUDIX domain 6.1E-11 148 272

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 40.82 21.78 59.86
5d_25C Five days - 25 degrees Celsius 39.24 20.73 57.76
7d_25C Seven days - 25 degrees Celsius 33.25 16.84 49.66
10d_25C Ten days - 25 degrees Celsius 26.80 12.95 40.65
7d_15C Seven days - 15 degrees Celsius 56.95 32.03 81.87
7d_30C Seven days - 30 degrees Celsius 27.91 13.45 42.37

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.924821 no
3d_25C 7d_25C 0.507695 no
3d_25C 7d_15C 0.200770 no
3d_25C 7d_30C 0.177837 no
3d_25C 10d_25C 0.124667 no
5d_25C 7d_25C 0.616626 no
5d_25C 7d_15C 0.151856 no
5d_25C 7d_30C 0.245212 no
5d_25C 10d_25C 0.184143 no
7d_25C 7d_15C 0.028642 yes
7d_25C 7d_30C 0.611086 no
7d_25C 10d_25C 0.517891 no
7d_15C 7d_30C 0.004840 yes
7d_15C 10d_25C 0.003625 yes
7d_30C 10d_25C 0.928960 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g221.t1
MGKSNLDLVGECDNFPYYEDDRDVYTENLKNYHAFKVSGYDCTLGYILNAVVEKFPWSEKSWAIDSTAQTVTLVT
PEGATPAHRSKLVAADIAEAVKQKKFEVLQGWRNETYAVYGPGGEFLLEMERAATPLFGIVSYGAHLTGYVQDES
GIKIWVPRRAKNKQTYPSLLDNTVAGGMCTGETPFECIVREAMEEASLPESVVRAATVSVGCVTYSHVRDVRAGG
ETGLIQPEIEYVYELRLDPETTPKPGDNEVEEFKLLSIPEVQAALARGEFKPNCANIMIDFFVRHGLLTPENEPD
FLQIVARLHRRLEYPTASHCAR*
Coding >Pro_DTO377G3_2|g221.t1
ATGGGCAAATCCAATTTAGACCTGGTCGGCGAATGCGATAACTTCCCCTACTACGAGGATGATCGCGACGTCTAC
ACGGAGAACCTGAAGAACTATCATGCATTCAAAGTCTCCGGATACGACTGTACACTCGGTTATATTCTCAATGCA
GTCGTTGAGAAATTTCCCTGGTCGGAAAAGAGCTGGGCCATTGACTCGACTGCGCAGACCGTGACGCTAGTGACA
CCGGAGGGAGCCACCCCGGCACACCGGAGCAAGCTCGTCGCAGCAGACATAGCCGAAGCCGTGAAACAAAAAAAG
TTCGAAGTGCTGCAAGGCTGGCGCAACGAGACCTACGCAGTCTACGGCCCGGGCGGAGAATTCCTACTCGAGATG
GAGCGCGCTGCGACCCCACTCTTCGGCATCGTATCCTACGGCGCCCATCTTACGGGCTACGTTCAGGATGAATCC
GGTATCAAGATCTGGGTCCCACGCCGCGCAAAGAACAAGCAGACCTACCCAAGCCTCCTTGATAACACCGTCGCC
GGCGGTATGTGCACCGGCGAGACGCCGTTTGAGTGTATAGTCCGCGAAGCTATGGAAGAGGCATCCTTGCCCGAG
TCGGTGGTGCGCGCTGCGACTGTCTCCGTGGGCTGTGTTACGTACTCACATGTACGGGATGTACGAGCGGGCGGC
GAGACGGGCCTCATTCAGCCTGAGATTGAATATGTATACGAGCTCAGGCTTGACCCTGAAACTACCCCGAAACCT
GGGGATAATGAGGTCGAGGAATTCAAGTTGTTGTCGATTCCGGAGGTGCAGGCGGCTTTGGCGCGCGGCGAGTTC
AAGCCCAATTGTGCTAATATCATGATTGATTTCTTTGTGAGGCATGGGCTGCTGACGCCAGAGAATGAGCCGGAT
TTCTTGCAGATTGTTGCTAGATTGCATCGTCGCTTAGAATACCCGACTGCTTCGCATTGCGCAAGGTAG
Transcript >Pro_DTO377G3_2|g221.t1
ATGGGCAAATCCAATTTAGACCTGGTCGGCGAATGCGATAACTTCCCCTACTACGAGGATGATCGCGACGTCTAC
ACGGAGAACCTGAAGAACTATCATGCATTCAAAGTCTCCGGATACGACTGTACACTCGGTTATATTCTCAATGCA
GTCGTTGAGAAATTTCCCTGGTCGGAAAAGAGCTGGGCCATTGACTCGACTGCGCAGACCGTGACGCTAGTGACA
CCGGAGGGAGCCACCCCGGCACACCGGAGCAAGCTCGTCGCAGCAGACATAGCCGAAGCCGTGAAACAAAAAAAG
TTCGAAGTGCTGCAAGGCTGGCGCAACGAGACCTACGCAGTCTACGGCCCGGGCGGAGAATTCCTACTCGAGATG
GAGCGCGCTGCGACCCCACTCTTCGGCATCGTATCCTACGGCGCCCATCTTACGGGCTACGTTCAGGATGAATCC
GGTATCAAGATCTGGGTCCCACGCCGCGCAAAGAACAAGCAGACCTACCCAAGCCTCCTTGATAACACCGTCGCC
GGCGGTATGTGCACCGGCGAGACGCCGTTTGAGTGTATAGTCCGCGAAGCTATGGAAGAGGCATCCTTGCCCGAG
TCGGTGGTGCGCGCTGCGACTGTCTCCGTGGGCTGTGTTACGTACTCACATGTACGGGATGTACGAGCGGGCGGC
GAGACGGGCCTCATTCAGCCTGAGATTGAATATGTATACGAGCTCAGGCTTGACCCTGAAACTACCCCGAAACCT
GGGGATAATGAGGTCGAGGAATTCAAGTTGTTGTCGATTCCGGAGGTGCAGGCGGCTTTGGCGCGCGGCGAGTTC
AAGCCCAATTGTGCTAATATCATGATTGATTTCTTTGTGAGGCATGGGCTGCTGACGCCAGAGAATGAGCCGGAT
TTCTTGCAGATTGTTGCTAGATTGCATCGTCGCTTAGAATACCCGACTGCTTCGCATTGCGCAAGGTAG
Gene >Pro_DTO377G3_2|g221.t1
ATGGGCAAATCCAATTTAGACCTGGTCGGCGAATGCGATAAGTAAAGCTGTCCCAACTCGGTTTCTCTCAATTCG
CGTTTTCTCTTACACCCCACCCCGCAGCTTCCCCTACTACGAGGATGATCGCGACGTCTACACGGAGAACCTGAA
GAACTATCATGCATTCAAAGTCTCCGGATACGACTGTACACTCGGTTATATTCTCAATGCAGTCGTTGAGAAATT
TCCCTGGTCGGAAAAGAGCTGGGCCATTGACTCGACTGCGCAGACCGTGACGCTAGTGACACCGGAGGGAGCCAC
CCCGGCACACCGGAGCAAGCTCGTCGCAGCAGACATAGCCGAAGCCGTGAAACAAAAAAAGTTCGAAGTGCTGCA
AGGCTGGCGCAACGAGACCTACGCAGTCTACGGCCCGGGCGGAGAATTCCTACTCGAGATGGAGCGCGCTGCGAC
CCCACTCTTCGGCATCGTATCCTACGGCGCCCATCTTACGGGCTACGTTCAGGATGAATCCGGTATCAAGATCTG
GGTCCCACGCCGCGCAAAGAACAAGCAGACCTACCCAAGCCTCCTTGATAACACCGTCGCCGGCGGTATGTGCAC
CGGCGAGACGCCGTTTGAGTGTATAGTCCGCGAAGCTATGGAAGAGGCATCCTTGCCCGAGTCGGTGGTGCGCGC
TGCGACTGTCTCCGTGGGCTGTGTTACGTACTCACATGTACGGGATGTACGAGCGGGCGGCGAGACGGGCCTCAT
TCAGCCTGAGATTGAATATGTATACGAGCTCAGGCTTGACCCTGAAACTACCCCGAAACCTGGGGATAATGAGGT
CGAGGAATTCAAGTTGTTGTCGATTCCGGAGGTGCAGGCGGCTTTGGCGCGCGGCGAGTTCAAGCCCAATTGTGC
TAATATCATGATTGATTTCTTTGTGAGGCATGGGCTGCTGACGCCAGAGAATGAGCCGGATTTCTTGCAGATTGT
TGCTAGATTGCATCGTCGCTTAGAATACCCGACTGCTTCGCATTGCGCAAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail