Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2187.t1
Gene name
Locationscaffold_02:1874957..1882031
Strand-
Gene length (bp)7074
Transcript length (bp)6921
Coding sequence length (bp)6921
Protein length (aa) 2307

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04054 Not1 CCR4-Not complex component, Not1 2.0E-139 1928 2293
PF16415 CNOT1_CAF1_bind CCR4-NOT transcription complex subunit 1 CAF1-binding domain 3.1E-95 1034 1255
PF12842 DUF3819 CCR4-Not complex, Not1 subunit, domain of unknown function DUF3819 4.0E-51 1318 1456
PF16417 CNOT1_TTP_bind CCR4-NOT transcription complex subunit 1 TTP binding domain 3.9E-41 819 970
PF16418 CNOT1_HEAT CCR4-NOT transcription complex subunit 1 HEAT repeat 4.2E-26 641 784

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
CCR4-Not complex component, Not1

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2187.t1
MTFPPPHPSAQSSIASGTDKSSSTRTDIGAWGRSVSQSGARRGLTPLATNISSAAPPTASRGLDAGLGVSTPSSF
SAVLSSARGLSGGSPKHTSSPFTSLQSGSQQHATTLSSPKFRAHTPSIGSHLASATGSAPGGGGTGGGGGGPGSS
RGVFSPLSSGTTVNSPTGFASDKPGSTNAHSSQSSLTKISIAQVFLLLDSITEKEGKEKWETKAAQIHKLVTSNG
MEVFSKYFRRLLTGNAPQIFPGVNKSVENAGNYPLLVQEMQKVSSDMEQSQKIAETVDTSEGDIFRDFDLSTFLD
HFRLDPVVKVSLALAFKLTSKSDLRAKADAILSNSIAPFLQSLASPTEVTKDYSNSFLGMTIERFILYPPRNFTD
DVKAKLVYAANLRFQKLGLDMPFEVSSALQMFNFVNPQYVLVRQLHAKGARATANTETISELLNSDQRNWSEEHL
ASALLFMILSQYWEQFSLETFLSAYNDKPINWPLVFRHFDREGLRVDPKQFTKLYNVLSAMSVDDSSLDVQKLWG
GDWEHRDTQMSFLTAFVASRIDPSHIPNLRATFPTDFFEDAPEIVKLQGERAAKSPLRSMDAMKAIFDLALFSQA
SWAATESQLLIKAVVQFDLPVFLVSALAIPQPWTSVQQSFVLRTFIVFISKQEDGYQLALQGAWRQERQWVSEQL
FTTFTQDPTSTAVIYEHAAAYGWLDYLLGFTNGLALDLACYSHRKSPFDLEQWVRNAAQKGAIDMGGLLSKFLRI
KAEDELHVQRKEQSAHQMVSLAVKTVYTLLSVLEEYVGDRENLTPVQRICIQTYPRLINYGEGFDDVIDANGENG
NTLPESIDKQMQELFGKMYHEELSLREMLELMRKYKSSRDPTEQDLFACMVHGLVDEYHCYHEYPLEALTKTAVM
FGGIINFRLVDGITLKVGLGMILEAVREHEPHDPMYKFGVEAIEQLINRLPEWAGFCHLLFQIPSLQGTPIYQKA
EEVLREQGNQIGEAEAGPFDGLASVPLTNGNSVDSPIADGSVRKFRAVQLDPPLRSELYEEPDEDIQDKILFVLN
NVSEQNIDEKLEDLREVLRDQHHQWFAAYLVEERAKLQPNFQQLYLDLLGRIGDKILWAEVLRETYVSVAKLINS
EGTLTSSTDRGHLKNLGAWLGSLTIAKDKPIKHKNIYFKGLLLEGYDTQRLMVTIPFTCKVLVQATKSTVFKPPN
PWLMDILGLLLELYHFAELKLNLKFEIEVLCKDLDLDHKTIEPAIVIRDRAAHAEEQLSTVNAPEGLEPFEDLSL
SAINPAIRNERLSPAAIMSTLPSLDKILVLPSSASSMVDPTILKQIVHTAVERAIAEIITPVVERSVTIASISTV
QLVSKDFAMEPDEERVRHAAGIMVRQLAGSLALVTCKEPLKVSMTNYIRMIQQEYSEQPMPEGLILMCVNDNLDA
ACGIVEKAAEEKSLPEIEKVIEPQLEARRRHLASRSNDPFIDPSMNRWGLFIPEPYRQTPGGLNKEQLAIYEEFA
RQSRGPAPSTDASAGRQLPDVLGESYPAIPNLSTPAEQPAIPHRTPQTQPAVSQMPPVQTNGFLDAQSPRERVES
LVSDLQQSARSAPEEHVKDLGRDSAVLQEYNQALRSILASTNGEELARLTSLKVCTLLYSQPHGSLEIEVLVHLL
AKLCDMSSLIARYTWALLSEVDDEHMFNVPVTVALIDAGLLDIRRVDTNLTRLILSRNVPALELLGNLMDRVLFN
EEPSALRSDFSGSLDAMSQWLAEDGSVTPGLEIVRKLRESGIPEVINSLLTDQARSKRDQMEYIFSEWIGIYKAP
GATDRTFHSFLQDLHNRQVMNSQEDSALFFRLSIDISVAMFEHESQNPNGGSLDEAFLYIDALAKLVILLVRFQG
ETAGAVKASKATYFNSILSLLVLVLNHHQVMRGEAFNQRVFFRLFSSILCEYSMNGLQHTEQHQGMIFALANKFL
SFQPRYVPGFVYGWLCLVSHRVFMSDMLNMPDRAGWAPYCEIIQALLSYMGEQLKAANIIYVAKDLYKGVLRILL
ILHHDFPEFVAENHFQFCNVIPAHCAQLRNLVLSAYPSSFQKLPDPFREGLKVERIEEMREIPKIAGDIVAPLQL
ANIKDVVDDVLQNDNISDSAVQQLCDAILNPEFKETGLLFVPVDVDVVLVNALVLYIGQQAAVEHASKGNTRSAF
ENSTHAALLEKIAQVLRPESRYYLLSAMANQLRYPNSHTYFFSFTILRLFGVDYSEQDDSDIRQQIIRVLLERLI
VHRPHPWGLIITLQELLQNRSYSFFRLPFIQAAPEIGRLFDALLQHIQQQSPRPIA*
Coding >Pro_DTO377G3_2|g2187.t1
ATGACCTTCCCTCCCCCTCACCCTTCCGCCCAATCGTCGATTGCTTCTGGCACCGATAAATCTTCTTCGACCAGG
ACCGATATTGGTGCCTGGGGTCGGTCCGTGTCGCAGTCCGGCGCACGTCGTGGGTTGACTCCACTCGCGACCAAC
ATATCCTCCGCCGCTCCCCCCACGGCTTCCCGGGGCTTGGACGCAGGCCTTGGGGTTTCGACACCATCTTCTTTC
TCTGCCGTGCTGAGCTCTGCTAGGGGTCTCTCCGGTGGAAGTCCCAAACACACGTCTTCGCCCTTCACATCATTG
CAATCTGGCTCGCAACAGCACGCAACAACCCTTTCGTCCCCTAAATTCCGAGCTCACACCCCTTCTATAGGGTCC
CATTTGGCCTCTGCTACAGGCTCCGCCCCGGGTGGAGGAGGAACTGGGGGAGGAGGTGGTGGGCCGGGATCTTCC
CGAGGCGTCTTTTCGCCGCTCTCGTCCGGAACAACCGTGAATTCTCCCACAGGTTTTGCTTCTGACAAGCCGGGT
TCCACAAACGCCCACTCGAGCCAATCGTCGCTCACCAAAATATCTATTGCCCAGGTGTTCTTGTTACTGGATTCT
ATTACGGAGAAGGAAGGAAAAGAGAAGTGGGAGACAAAGGCTGCCCAGATACACAAGCTTGTGACTTCGAACGGA
ATGGAGGTCTTTTCCAAATACTTTCGCCGCCTCCTAACAGGAAATGCGCCACAAATCTTCCCCGGTGTTAACAAA
TCCGTTGAAAATGCGGGCAACTACCCTCTCCTTGTCCAGGAGATGCAGAAAGTGTCCTCGGACATGGAGCAGTCT
CAGAAAATCGCTGAGACAGTAGATACTTCCGAAGGAGATATCTTCCGCGACTTCGACCTTTCCACTTTCCTAGAT
CATTTCCGACTCGATCCAGTTGTCAAGGTTTCCCTTGCATTGGCCTTCAAACTGACTAGCAAGTCAGATCTTCGT
GCTAAAGCCGATGCCATCCTCTCGAATTCCATTGCCCCTTTCTTACAGAGCTTGGCGAGTCCTACCGAAGTGACT
AAGGATTACAGCAACTCCTTCCTTGGCATGACGATTGAACGTTTTATCTTATACCCTCCCCGCAATTTTACCGAC
GATGTCAAGGCGAAGCTGGTTTACGCAGCCAATCTGCGATTCCAAAAACTTGGCTTGGATATGCCATTCGAAGTT
TCCTCTGCTTTACAGATGTTCAATTTTGTGAACCCTCAATATGTCCTTGTACGACAGCTTCATGCCAAGGGAGCT
CGTGCCACTGCGAATACCGAGACAATAAGTGAATTGCTAAATTCAGACCAGAGGAATTGGAGCGAAGAACATCTA
GCCAGCGCCCTTCTCTTCATGATCTTGTCGCAATATTGGGAACAATTCTCACTAGAGACATTCTTAAGTGCATAT
AACGACAAGCCAATAAACTGGCCCCTCGTGTTCCGCCACTTCGATCGTGAGGGCCTCAGAGTGGATCCGAAACAA
TTCACCAAGTTGTACAATGTTCTTTCCGCCATGTCGGTCGACGACTCCTCTTTGGATGTTCAAAAGCTTTGGGGT
GGAGACTGGGAGCATCGTGACACGCAGATGTCATTCCTAACAGCTTTTGTGGCCTCTCGGATCGACCCATCGCAC
ATCCCTAATCTTCGCGCAACTTTCCCCACTGACTTCTTTGAAGATGCCCCTGAAATCGTCAAACTGCAAGGCGAG
CGTGCGGCAAAGTCACCTCTTCGGTCCATGGACGCTATGAAGGCAATTTTCGACCTTGCCTTGTTCTCCCAGGCT
TCGTGGGCTGCGACAGAAAGCCAGCTCCTTATAAAGGCGGTCGTTCAGTTTGATTTGCCAGTTTTCCTCGTTTCT
GCTCTGGCTATTCCGCAGCCGTGGACCAGTGTCCAGCAGAGCTTTGTCTTGCGCACATTCATTGTCTTCATCTCG
AAGCAAGAGGATGGGTACCAGCTCGCTCTCCAAGGTGCTTGGAGACAAGAACGACAGTGGGTATCGGAACAACTT
TTCACCACATTCACTCAGGATCCCACCTCCACCGCTGTGATCTATGAGCACGCTGCAGCATACGGATGGCTCGAT
TATCTCCTTGGGTTCACTAACGGTCTTGCCCTCGATCTCGCCTGCTACTCCCACCGCAAGAGTCCCTTTGATCTT
GAGCAGTGGGTTCGGAATGCCGCACAGAAAGGCGCTATTGATATGGGTGGTCTGCTCTCTAAGTTCCTGCGAATC
AAGGCCGAGGACGAATTGCACGTCCAACGGAAGGAGCAGTCTGCTCATCAAATGGTCAGCCTCGCAGTCAAAACT
GTTTATACGCTTTTGTCTGTATTGGAGGAATACGTCGGGGACCGCGAAAATCTCACCCCTGTCCAGCGCATTTGC
ATCCAGACGTATCCTCGTCTGATCAACTACGGCGAAGGATTCGATGATGTAATCGACGCCAATGGCGAGAACGGC
AACACGTTGCCTGAGTCAATTGACAAGCAAATGCAAGAGCTCTTTGGTAAAATGTACCACGAGGAACTCTCGCTG
CGTGAGATGCTGGAGTTGATGCGCAAATACAAGTCTTCGCGCGACCCCACAGAACAAGATCTGTTCGCCTGCATG
GTGCACGGCCTGGTTGACGAATACCATTGCTACCATGAATACCCGCTCGAGGCTCTCACGAAGACTGCGGTCATG
TTCGGTGGCATAATCAACTTCCGTCTTGTTGATGGCATCACGCTGAAGGTCGGTCTCGGTATGATCCTCGAGGCT
GTCCGCGAGCATGAGCCTCATGACCCGATGTACAAGTTCGGCGTGGAAGCGATTGAACAGTTGATTAACCGTCTT
CCCGAGTGGGCTGGTTTCTGCCACCTGCTCTTCCAAATCCCCTCTCTCCAAGGCACACCCATATACCAAAAGGCA
GAGGAGGTGCTCCGTGAACAGGGAAACCAGATTGGCGAAGCGGAGGCAGGACCATTCGATGGTCTTGCTTCTGTG
CCTTTGACCAATGGCAATTCTGTTGACTCCCCCATCGCTGATGGCTCCGTGCGCAAGTTCCGTGCTGTTCAACTC
GACCCACCTCTTCGATCTGAGCTCTACGAAGAACCGGATGAAGACATTCAAGACAAGATTCTTTTCGTCCTTAAC
AATGTTTCCGAGCAGAACATTGACGAGAAACTTGAAGATCTACGAGAAGTGTTGCGTGACCAGCACCACCAGTGG
TTCGCCGCATACCTGGTGGAAGAACGTGCCAAGTTGCAGCCTAATTTCCAGCAGCTCTATCTTGATCTTCTTGGG
CGCATTGGTGACAAGATCCTCTGGGCTGAGGTCCTACGGGAGACCTATGTTAGTGTCGCTAAGTTGATTAACTCA
GAAGGCACCTTAACCTCGTCTACCGATCGCGGCCACCTGAAGAACCTTGGTGCTTGGCTTGGCTCACTGACTATT
GCCAAAGACAAACCTATTAAGCATAAGAACATCTACTTCAAGGGCTTGCTCCTCGAAGGATACGACACTCAACGC
CTCATGGTTACAATCCCCTTCACCTGCAAAGTTCTTGTGCAGGCTACCAAATCCACAGTCTTCAAACCACCCAAC
CCCTGGCTGATGGATATTTTGGGCCTGCTGTTGGAGCTTTATCATTTCGCCGAACTGAAGCTCAATCTCAAGTTT
GAAATCGAAGTTCTCTGTAAAGATCTTGATCTCGACCACAAGACAATTGAGCCGGCAATCGTCATTCGCGATCGT
GCTGCACATGCCGAGGAACAACTGTCAACTGTTAACGCTCCGGAAGGTCTTGAGCCATTTGAAGACTTGTCACTC
AGCGCTATTAACCCAGCCATCCGGAATGAGAGATTGTCCCCCGCCGCCATCATGTCAACACTGCCAAGTCTTGAC
AAGATCCTTGTCCTGCCCTCATCGGCGAGCAGCATGGTCGATCCTACAATTCTTAAACAGATTGTGCATACTGCA
GTCGAGCGCGCCATTGCCGAGATCATTACCCCCGTAGTCGAGCGTTCTGTGACCATCGCATCCATCTCCACCGTA
CAACTTGTCTCCAAGGACTTTGCCATGGAACCCGATGAGGAACGCGTGCGCCACGCCGCGGGCATCATGGTCCGA
CAACTTGCTGGTAGCCTGGCACTCGTCACCTGCAAAGAGCCTCTGAAGGTTAGCATGACTAACTATATCCGCATG
ATTCAGCAAGAGTACTCCGAGCAGCCTATGCCCGAAGGCTTGATTCTGATGTGTGTCAACGATAACTTGGATGCT
GCCTGTGGCATTGTCGAGAAAGCTGCAGAGGAAAAGTCCCTGCCCGAGATCGAGAAGGTGATTGAGCCTCAATTG
GAGGCTCGTCGTCGCCATCTGGCCAGTCGTTCTAACGATCCTTTCATTGATCCTTCAATGAACCGTTGGGGATTG
TTCATTCCGGAGCCTTACCGGCAAACGCCTGGGGGTCTCAACAAGGAGCAACTCGCCATCTACGAAGAGTTTGCC
CGTCAATCCCGAGGCCCGGCGCCATCCACTGATGCATCGGCCGGCCGTCAACTCCCCGACGTGCTTGGAGAATCC
TATCCTGCTATTCCAAACCTTTCTACCCCGGCTGAGCAGCCAGCCATTCCTCACAGAACTCCCCAGACACAGCCT
GCTGTTTCTCAAATGCCCCCAGTCCAGACTAATGGGTTCCTTGATGCTCAAAGCCCCCGGGAAAGAGTGGAAAGC
CTCGTCTCCGATCTCCAGCAGTCTGCTCGCAGCGCCCCTGAAGAACACGTCAAGGATCTTGGCAGAGATAGTGCA
GTTCTTCAAGAATACAACCAGGCACTGCGCAGCATCCTTGCCTCGACGAATGGAGAGGAGTTGGCGCGACTAACC
TCTTTGAAGGTTTGCACCCTTTTGTATTCCCAGCCACATGGATCCCTCGAGATTGAGGTCCTCGTGCACCTGCTT
GCCAAGCTATGCGATATGTCCAGTCTCATTGCCCGGTACACGTGGGCACTGCTTTCCGAAGTTGATGATGAGCAC
ATGTTCAATGTGCCGGTCACCGTTGCTCTCATCGACGCAGGCCTCCTAGACATCCGTCGGGTCGATACGAACCTG
ACCCGACTCATTCTATCTAGGAATGTTCCTGCTTTGGAGTTGCTGGGCAACCTGATGGATCGCGTTCTTTTCAAC
GAAGAACCATCGGCACTTCGATCAGACTTCTCCGGCAGTCTAGATGCTATGAGCCAATGGCTTGCTGAGGATGGA
AGCGTTACTCCCGGTCTCGAAATCGTGCGAAAGCTGCGCGAGTCCGGTATTCCCGAGGTCATCAACTCTCTCCTT
ACAGACCAAGCTAGGTCCAAGCGAGACCAAATGGAGTACATCTTCAGCGAGTGGATCGGTATTTACAAGGCCCCC
GGTGCCACTGACCGCACCTTCCACTCTTTCCTGCAGGACCTCCACAACCGCCAAGTGATGAACAGCCAGGAGGAC
TCAGCACTATTTTTCCGTCTCAGCATCGACATTTCCGTCGCCATGTTTGAGCATGAGTCTCAGAACCCCAACGGC
GGCAGCCTTGATGAGGCCTTCCTTTACATCGATGCCCTCGCTAAGCTCGTGATTCTTCTCGTCAGATTCCAGGGC
GAGACCGCTGGCGCCGTCAAAGCTAGTAAGGCTACGTACTTCAACTCTATTCTGTCTCTCTTGGTTCTGGTCCTC
AATCACCACCAGGTCATGAGAGGAGAAGCTTTCAACCAGCGTGTATTCTTCCGTCTCTTCTCGAGTATTCTGTGC
GAGTACTCTATGAACGGCCTCCAGCACACTGAGCAGCACCAGGGAATGATCTTCGCCTTGGCCAACAAATTCCTC
TCCTTCCAGCCCCGTTACGTGCCCGGGTTCGTTTATGGCTGGCTTTGCTTAGTCTCTCACCGCGTGTTCATGTCT
GACATGCTCAACATGCCTGATCGTGCAGGATGGGCGCCTTACTGCGAGATCATCCAAGCATTGCTATCCTACATG
GGCGAGCAATTAAAGGCTGCCAACATTATTTACGTTGCCAAAGACCTATACAAGGGCGTTCTCCGTATCTTGCTG
ATTCTGCACCACGATTTCCCCGAGTTCGTGGCTGAGAACCATTTCCAGTTCTGCAATGTGATCCCGGCTCATTGC
GCTCAGCTCCGCAATCTTGTTCTCAGTGCCTACCCCTCGTCGTTCCAGAAACTTCCCGATCCTTTCCGCGAAGGA
TTGAAGGTCGAGCGTATCGAGGAGATGCGGGAAATTCCCAAGATCGCCGGTGATATCGTTGCTCCTTTGCAGCTT
GCCAACATCAAGGACGTTGTTGATGATGTACTCCAGAATGACAACATCTCCGATTCTGCTGTTCAGCAGCTCTGT
GACGCCATTCTTAACCCCGAATTCAAGGAAACTGGCCTCCTCTTTGTCCCCGTCGACGTGGATGTCGTCCTAGTC
AACGCGCTTGTTTTGTATATTGGCCAACAAGCTGCAGTGGAGCATGCCTCCAAGGGCAATACCCGCAGCGCCTTT
GAGAACTCGACTCACGCTGCTCTTCTGGAGAAGATCGCCCAAGTTCTGCGTCCTGAAAGTCGCTACTACTTACTC
AGTGCAATGGCCAACCAGCTCCGCTACCCCAACAGCCACACCTACTTCTTCAGCTTCACTATTCTCCGTCTGTTT
GGTGTGGATTACTCTGAGCAAGATGACTCGGATATCCGCCAACAAATCATTCGCGTGTTGTTGGAGCGACTGATT
GTGCACCGCCCGCATCCATGGGGTCTGATCATCACCCTGCAGGAGCTCCTCCAGAACCGGAGCTACTCATTCTTC
CGCCTCCCCTTCATTCAGGCGGCACCTGAGATCGGTCGTCTTTTCGACGCTCTTCTCCAACATATCCAACAACAG
AGCCCTCGGCCCATCGCCTAA
Transcript >Pro_DTO377G3_2|g2187.t1
ATGACCTTCCCTCCCCCTCACCCTTCCGCCCAATCGTCGATTGCTTCTGGCACCGATAAATCTTCTTCGACCAGG
ACCGATATTGGTGCCTGGGGTCGGTCCGTGTCGCAGTCCGGCGCACGTCGTGGGTTGACTCCACTCGCGACCAAC
ATATCCTCCGCCGCTCCCCCCACGGCTTCCCGGGGCTTGGACGCAGGCCTTGGGGTTTCGACACCATCTTCTTTC
TCTGCCGTGCTGAGCTCTGCTAGGGGTCTCTCCGGTGGAAGTCCCAAACACACGTCTTCGCCCTTCACATCATTG
CAATCTGGCTCGCAACAGCACGCAACAACCCTTTCGTCCCCTAAATTCCGAGCTCACACCCCTTCTATAGGGTCC
CATTTGGCCTCTGCTACAGGCTCCGCCCCGGGTGGAGGAGGAACTGGGGGAGGAGGTGGTGGGCCGGGATCTTCC
CGAGGCGTCTTTTCGCCGCTCTCGTCCGGAACAACCGTGAATTCTCCCACAGGTTTTGCTTCTGACAAGCCGGGT
TCCACAAACGCCCACTCGAGCCAATCGTCGCTCACCAAAATATCTATTGCCCAGGTGTTCTTGTTACTGGATTCT
ATTACGGAGAAGGAAGGAAAAGAGAAGTGGGAGACAAAGGCTGCCCAGATACACAAGCTTGTGACTTCGAACGGA
ATGGAGGTCTTTTCCAAATACTTTCGCCGCCTCCTAACAGGAAATGCGCCACAAATCTTCCCCGGTGTTAACAAA
TCCGTTGAAAATGCGGGCAACTACCCTCTCCTTGTCCAGGAGATGCAGAAAGTGTCCTCGGACATGGAGCAGTCT
CAGAAAATCGCTGAGACAGTAGATACTTCCGAAGGAGATATCTTCCGCGACTTCGACCTTTCCACTTTCCTAGAT
CATTTCCGACTCGATCCAGTTGTCAAGGTTTCCCTTGCATTGGCCTTCAAACTGACTAGCAAGTCAGATCTTCGT
GCTAAAGCCGATGCCATCCTCTCGAATTCCATTGCCCCTTTCTTACAGAGCTTGGCGAGTCCTACCGAAGTGACT
AAGGATTACAGCAACTCCTTCCTTGGCATGACGATTGAACGTTTTATCTTATACCCTCCCCGCAATTTTACCGAC
GATGTCAAGGCGAAGCTGGTTTACGCAGCCAATCTGCGATTCCAAAAACTTGGCTTGGATATGCCATTCGAAGTT
TCCTCTGCTTTACAGATGTTCAATTTTGTGAACCCTCAATATGTCCTTGTACGACAGCTTCATGCCAAGGGAGCT
CGTGCCACTGCGAATACCGAGACAATAAGTGAATTGCTAAATTCAGACCAGAGGAATTGGAGCGAAGAACATCTA
GCCAGCGCCCTTCTCTTCATGATCTTGTCGCAATATTGGGAACAATTCTCACTAGAGACATTCTTAAGTGCATAT
AACGACAAGCCAATAAACTGGCCCCTCGTGTTCCGCCACTTCGATCGTGAGGGCCTCAGAGTGGATCCGAAACAA
TTCACCAAGTTGTACAATGTTCTTTCCGCCATGTCGGTCGACGACTCCTCTTTGGATGTTCAAAAGCTTTGGGGT
GGAGACTGGGAGCATCGTGACACGCAGATGTCATTCCTAACAGCTTTTGTGGCCTCTCGGATCGACCCATCGCAC
ATCCCTAATCTTCGCGCAACTTTCCCCACTGACTTCTTTGAAGATGCCCCTGAAATCGTCAAACTGCAAGGCGAG
CGTGCGGCAAAGTCACCTCTTCGGTCCATGGACGCTATGAAGGCAATTTTCGACCTTGCCTTGTTCTCCCAGGCT
TCGTGGGCTGCGACAGAAAGCCAGCTCCTTATAAAGGCGGTCGTTCAGTTTGATTTGCCAGTTTTCCTCGTTTCT
GCTCTGGCTATTCCGCAGCCGTGGACCAGTGTCCAGCAGAGCTTTGTCTTGCGCACATTCATTGTCTTCATCTCG
AAGCAAGAGGATGGGTACCAGCTCGCTCTCCAAGGTGCTTGGAGACAAGAACGACAGTGGGTATCGGAACAACTT
TTCACCACATTCACTCAGGATCCCACCTCCACCGCTGTGATCTATGAGCACGCTGCAGCATACGGATGGCTCGAT
TATCTCCTTGGGTTCACTAACGGTCTTGCCCTCGATCTCGCCTGCTACTCCCACCGCAAGAGTCCCTTTGATCTT
GAGCAGTGGGTTCGGAATGCCGCACAGAAAGGCGCTATTGATATGGGTGGTCTGCTCTCTAAGTTCCTGCGAATC
AAGGCCGAGGACGAATTGCACGTCCAACGGAAGGAGCAGTCTGCTCATCAAATGGTCAGCCTCGCAGTCAAAACT
GTTTATACGCTTTTGTCTGTATTGGAGGAATACGTCGGGGACCGCGAAAATCTCACCCCTGTCCAGCGCATTTGC
ATCCAGACGTATCCTCGTCTGATCAACTACGGCGAAGGATTCGATGATGTAATCGACGCCAATGGCGAGAACGGC
AACACGTTGCCTGAGTCAATTGACAAGCAAATGCAAGAGCTCTTTGGTAAAATGTACCACGAGGAACTCTCGCTG
CGTGAGATGCTGGAGTTGATGCGCAAATACAAGTCTTCGCGCGACCCCACAGAACAAGATCTGTTCGCCTGCATG
GTGCACGGCCTGGTTGACGAATACCATTGCTACCATGAATACCCGCTCGAGGCTCTCACGAAGACTGCGGTCATG
TTCGGTGGCATAATCAACTTCCGTCTTGTTGATGGCATCACGCTGAAGGTCGGTCTCGGTATGATCCTCGAGGCT
GTCCGCGAGCATGAGCCTCATGACCCGATGTACAAGTTCGGCGTGGAAGCGATTGAACAGTTGATTAACCGTCTT
CCCGAGTGGGCTGGTTTCTGCCACCTGCTCTTCCAAATCCCCTCTCTCCAAGGCACACCCATATACCAAAAGGCA
GAGGAGGTGCTCCGTGAACAGGGAAACCAGATTGGCGAAGCGGAGGCAGGACCATTCGATGGTCTTGCTTCTGTG
CCTTTGACCAATGGCAATTCTGTTGACTCCCCCATCGCTGATGGCTCCGTGCGCAAGTTCCGTGCTGTTCAACTC
GACCCACCTCTTCGATCTGAGCTCTACGAAGAACCGGATGAAGACATTCAAGACAAGATTCTTTTCGTCCTTAAC
AATGTTTCCGAGCAGAACATTGACGAGAAACTTGAAGATCTACGAGAAGTGTTGCGTGACCAGCACCACCAGTGG
TTCGCCGCATACCTGGTGGAAGAACGTGCCAAGTTGCAGCCTAATTTCCAGCAGCTCTATCTTGATCTTCTTGGG
CGCATTGGTGACAAGATCCTCTGGGCTGAGGTCCTACGGGAGACCTATGTTAGTGTCGCTAAGTTGATTAACTCA
GAAGGCACCTTAACCTCGTCTACCGATCGCGGCCACCTGAAGAACCTTGGTGCTTGGCTTGGCTCACTGACTATT
GCCAAAGACAAACCTATTAAGCATAAGAACATCTACTTCAAGGGCTTGCTCCTCGAAGGATACGACACTCAACGC
CTCATGGTTACAATCCCCTTCACCTGCAAAGTTCTTGTGCAGGCTACCAAATCCACAGTCTTCAAACCACCCAAC
CCCTGGCTGATGGATATTTTGGGCCTGCTGTTGGAGCTTTATCATTTCGCCGAACTGAAGCTCAATCTCAAGTTT
GAAATCGAAGTTCTCTGTAAAGATCTTGATCTCGACCACAAGACAATTGAGCCGGCAATCGTCATTCGCGATCGT
GCTGCACATGCCGAGGAACAACTGTCAACTGTTAACGCTCCGGAAGGTCTTGAGCCATTTGAAGACTTGTCACTC
AGCGCTATTAACCCAGCCATCCGGAATGAGAGATTGTCCCCCGCCGCCATCATGTCAACACTGCCAAGTCTTGAC
AAGATCCTTGTCCTGCCCTCATCGGCGAGCAGCATGGTCGATCCTACAATTCTTAAACAGATTGTGCATACTGCA
GTCGAGCGCGCCATTGCCGAGATCATTACCCCCGTAGTCGAGCGTTCTGTGACCATCGCATCCATCTCCACCGTA
CAACTTGTCTCCAAGGACTTTGCCATGGAACCCGATGAGGAACGCGTGCGCCACGCCGCGGGCATCATGGTCCGA
CAACTTGCTGGTAGCCTGGCACTCGTCACCTGCAAAGAGCCTCTGAAGGTTAGCATGACTAACTATATCCGCATG
ATTCAGCAAGAGTACTCCGAGCAGCCTATGCCCGAAGGCTTGATTCTGATGTGTGTCAACGATAACTTGGATGCT
GCCTGTGGCATTGTCGAGAAAGCTGCAGAGGAAAAGTCCCTGCCCGAGATCGAGAAGGTGATTGAGCCTCAATTG
GAGGCTCGTCGTCGCCATCTGGCCAGTCGTTCTAACGATCCTTTCATTGATCCTTCAATGAACCGTTGGGGATTG
TTCATTCCGGAGCCTTACCGGCAAACGCCTGGGGGTCTCAACAAGGAGCAACTCGCCATCTACGAAGAGTTTGCC
CGTCAATCCCGAGGCCCGGCGCCATCCACTGATGCATCGGCCGGCCGTCAACTCCCCGACGTGCTTGGAGAATCC
TATCCTGCTATTCCAAACCTTTCTACCCCGGCTGAGCAGCCAGCCATTCCTCACAGAACTCCCCAGACACAGCCT
GCTGTTTCTCAAATGCCCCCAGTCCAGACTAATGGGTTCCTTGATGCTCAAAGCCCCCGGGAAAGAGTGGAAAGC
CTCGTCTCCGATCTCCAGCAGTCTGCTCGCAGCGCCCCTGAAGAACACGTCAAGGATCTTGGCAGAGATAGTGCA
GTTCTTCAAGAATACAACCAGGCACTGCGCAGCATCCTTGCCTCGACGAATGGAGAGGAGTTGGCGCGACTAACC
TCTTTGAAGGTTTGCACCCTTTTGTATTCCCAGCCACATGGATCCCTCGAGATTGAGGTCCTCGTGCACCTGCTT
GCCAAGCTATGCGATATGTCCAGTCTCATTGCCCGGTACACGTGGGCACTGCTTTCCGAAGTTGATGATGAGCAC
ATGTTCAATGTGCCGGTCACCGTTGCTCTCATCGACGCAGGCCTCCTAGACATCCGTCGGGTCGATACGAACCTG
ACCCGACTCATTCTATCTAGGAATGTTCCTGCTTTGGAGTTGCTGGGCAACCTGATGGATCGCGTTCTTTTCAAC
GAAGAACCATCGGCACTTCGATCAGACTTCTCCGGCAGTCTAGATGCTATGAGCCAATGGCTTGCTGAGGATGGA
AGCGTTACTCCCGGTCTCGAAATCGTGCGAAAGCTGCGCGAGTCCGGTATTCCCGAGGTCATCAACTCTCTCCTT
ACAGACCAAGCTAGGTCCAAGCGAGACCAAATGGAGTACATCTTCAGCGAGTGGATCGGTATTTACAAGGCCCCC
GGTGCCACTGACCGCACCTTCCACTCTTTCCTGCAGGACCTCCACAACCGCCAAGTGATGAACAGCCAGGAGGAC
TCAGCACTATTTTTCCGTCTCAGCATCGACATTTCCGTCGCCATGTTTGAGCATGAGTCTCAGAACCCCAACGGC
GGCAGCCTTGATGAGGCCTTCCTTTACATCGATGCCCTCGCTAAGCTCGTGATTCTTCTCGTCAGATTCCAGGGC
GAGACCGCTGGCGCCGTCAAAGCTAGTAAGGCTACGTACTTCAACTCTATTCTGTCTCTCTTGGTTCTGGTCCTC
AATCACCACCAGGTCATGAGAGGAGAAGCTTTCAACCAGCGTGTATTCTTCCGTCTCTTCTCGAGTATTCTGTGC
GAGTACTCTATGAACGGCCTCCAGCACACTGAGCAGCACCAGGGAATGATCTTCGCCTTGGCCAACAAATTCCTC
TCCTTCCAGCCCCGTTACGTGCCCGGGTTCGTTTATGGCTGGCTTTGCTTAGTCTCTCACCGCGTGTTCATGTCT
GACATGCTCAACATGCCTGATCGTGCAGGATGGGCGCCTTACTGCGAGATCATCCAAGCATTGCTATCCTACATG
GGCGAGCAATTAAAGGCTGCCAACATTATTTACGTTGCCAAAGACCTATACAAGGGCGTTCTCCGTATCTTGCTG
ATTCTGCACCACGATTTCCCCGAGTTCGTGGCTGAGAACCATTTCCAGTTCTGCAATGTGATCCCGGCTCATTGC
GCTCAGCTCCGCAATCTTGTTCTCAGTGCCTACCCCTCGTCGTTCCAGAAACTTCCCGATCCTTTCCGCGAAGGA
TTGAAGGTCGAGCGTATCGAGGAGATGCGGGAAATTCCCAAGATCGCCGGTGATATCGTTGCTCCTTTGCAGCTT
GCCAACATCAAGGACGTTGTTGATGATGTACTCCAGAATGACAACATCTCCGATTCTGCTGTTCAGCAGCTCTGT
GACGCCATTCTTAACCCCGAATTCAAGGAAACTGGCCTCCTCTTTGTCCCCGTCGACGTGGATGTCGTCCTAGTC
AACGCGCTTGTTTTGTATATTGGCCAACAAGCTGCAGTGGAGCATGCCTCCAAGGGCAATACCCGCAGCGCCTTT
GAGAACTCGACTCACGCTGCTCTTCTGGAGAAGATCGCCCAAGTTCTGCGTCCTGAAAGTCGCTACTACTTACTC
AGTGCAATGGCCAACCAGCTCCGCTACCCCAACAGCCACACCTACTTCTTCAGCTTCACTATTCTCCGTCTGTTT
GGTGTGGATTACTCTGAGCAAGATGACTCGGATATCCGCCAACAAATCATTCGCGTGTTGTTGGAGCGACTGATT
GTGCACCGCCCGCATCCATGGGGTCTGATCATCACCCTGCAGGAGCTCCTCCAGAACCGGAGCTACTCATTCTTC
CGCCTCCCCTTCATTCAGGCGGCACCTGAGATCGGTCGTCTTTTCGACGCTCTTCTCCAACATATCCAACAACAG
AGCCCTCGGCCCATCGCCTAA
Gene >Pro_DTO377G3_2|g2187.t1
ATGACCTTCCCTCCCCCTCACCCTTCCGCCCAATCGTCGATTGCTTCTGGCACCGATAAATCTTCTTCGACCAGG
ACCGATATTGGTGCCTGGGGTCGGTCCGTGTCGCAGTCCGGCGCACGTCGTGGGTTGACTCCACTCGCGACCAAC
ATATCCTCCGCCGCTCCCCCCACGGCTTCCCGGGGCTTGGACGCAGGCCTTGGGGTTTCGACACCATCTTCTTTC
TCTGCCGTGCTGAGCTCTGCTAGGGGTCTCTCCGGTGGAAGTCCCAAACACACGTCTTCGCCCTTCACATCATTG
CAATCTGGCTCGCAACAGCACGCAACAACCCTTTCGTCCCCTAAATTCCGAGCTCACACCCCTTCTATAGGGTCC
CATTTGGCCTCTGCTACAGGCTCCGCCCCGGGTGGAGGAGGAACTGGGGGAGGAGGTGGTGGGCCGGGATCTTCC
CGAGGCGTCTTTTCGCCGCTCTCGTCCGGAACAACCGTGAATTCTCCCACAGGTTTTGCTTCTGACAAGCCGGGT
TCCACAAACGCCCACTCGAGCCAATCGTCGCTCACCAAAATATCTATTGCCCAGGTGTTCTTGTTACTGGATTCT
ATTACGGAGAAGGAAGGAAAAGAGAAGTGGGAGACAAAGGCTGCCCAGATACACAAGGTTGGTGGTCCTTCCGTA
TATCCCAATCCAGTCGATTCTAATAACCGCAGCTTGTGACTTCGAACGGAATGGAGGTCTTTTCCAAATACTTTC
GCCGCCTCCTAACAGGAAATGCGCCACAAATCTTCCCCGGTGTTAACAAATCCGTTGAAAATGCGGGCAACTACC
CTCTCCTTGTCCAGGAGATGCAGAAAGTGTCCTCGGACATGGAGCAGTCTCAGAAAATCGCTGAGACAGTAGATA
CTTCCGAAGGAGATATCTTCCGCGACTTCGACCTTTCCACTTTCCTAGATCATTTCCGACTCGATCCAGTTGTCA
AGGTTTCCCTTGCATTGGCCTTCAAACTGACTAGCAAGTCAGATCTTCGTGCTAAAGGTATGTTTGCTCCTATCT
ACGCCTCTGGGTCGATCTAACCATCCTCATTAGCCGATGCCATCCTCTCGAATTCCATTGCCCCTTTCTTACAGA
GCTTGGCGAGTCCTACCGAAGTGACTAAGGATTACAGCAACTCCTTCCTTGGCATGACGATTGAACGTTTTATCT
TATACCCTCCCCGCAATTTTACCGACGATGTCAAGGCGAAGCTGGTTTACGCAGCCAATCTGCGATTCCAAAAAC
TTGGCTTGGATATGCCATTCGAAGTTTCCTCTGCTTTACAGATGTTCAATTTTGTGAACCCTCAATATGTCCTTG
TACGACAGCTTCATGCCAAGGGAGCTCGTGCCACTGCGAATACCGAGACAATAAGTGAATTGCTAAATTCAGACC
AGAGGAATTGGAGCGAAGAACATCTAGCCAGCGCCCTTCTCTTCATGATCTTGTCGCAATATTGGGAACAATTCT
CACTAGAGACATTCTTAAGTGCATATAACGACAAGCCAATAAACTGGCCCCTCGTGTTCCGCCACTTCGATCGTG
AGGGCCTCAGAGTGGATCCGAAACAATTCACCAAGTTGTACAATGTTCTTTCCGCCATGTCGGTCGACGACTCCT
CTTTGGATGTTCAAAAGCTTTGGGGTGGAGACTGGGAGCATCGTGACACGCAGATGTCATTCCTAACAGCTTTTG
TGGCCTCTCGGATCGACCCATCGCACATCCCTAATCTTCGCGCAACTTTCCCCACTGACTTCTTTGAAGATGCCC
CTGAAATCGTCAAACTGCAAGGCGAGCGTGCGGCAAAGTCACCTCTTCGGTCCATGGACGCTATGAAGGCAATTT
TCGACCTTGCCTTGTTCTCCCAGGCTTCGTGGGCTGCGACAGAAAGCCAGCTCCTTATAAAGGCGGTCGTTCAGT
TTGATTTGCCAGTTTTCCTCGTTTCTGCTCTGGCTATTCCGCAGCCGTGGACCAGTGTCCAGCAGAGCTTTGTCT
TGCGCACATTCATTGTCTTCATCTCGAAGCAAGAGGATGGGTACCAGCTCGCTCTCCAAGGTGCTTGGAGACAAG
AACGACAGTGGGTATCGGAACAACTTTTCACCACATTCACTCAGGATCCCACCTCCACCGCTGTGATCTATGAGC
ACGCTGCAGCATACGGATGGCTCGATTATCTCCTTGGGTTCACTAACGGTCTTGCCCTCGATCTCGCCTGCTACT
CCCACCGCAAGAGTCCCTTTGATCTTGAGCAGTGGGTTCGGAATGCCGCACAGAAAGGCGCTATTGATATGGGTG
GTCTGCTCTCTAAGTTCCTGCGAATCAAGGCCGAGGACGAATTGCACGTCCAACGGAAGGAGCAGTCTGCTCATC
AAATGGTCAGCCTCGCAGTCAAAACTGTTTATACGCTTTTGTCTGTATTGGAGGAATACGTCGGGGACCGCGAAA
ATCTCACCCCTGTCCAGCGCATTTGCATCCAGACGTATCCTCGTCTGATCAACTACGGCGAAGGATTCGATGATG
TAATCGACGCCAATGGCGAGAACGGCAACACGTTGCCTGAGTCAATTGACAAGCAAATGCAAGAGCTCTTTGGTA
AAATGTACCACGAGGAACTCTCGCTGCGTGAGATGCTGGAGTTGATGCGCAAATACAAGTCTTCGCGCGACCCCA
CAGAACAAGATCTGTTCGCCTGCATGGTGCACGGCCTGGTTGACGAATACCATTGCTACCATGAATACCCGCTCG
AGGCTCTCACGAAGACTGCGGTCATGTTCGGTGGCATAATCAACTTCCGTCTTGTTGATGGCATCACGCTGAAGG
TCGGTCTCGGTATGATCCTCGAGGCTGTCCGCGAGCATGAGCCTCATGACCCGATGTACAAGTTCGGCGTGGAAG
CGATTGAACAGTTGATTAACCGTCTTCCCGAGTGGGCTGGTTTCTGCCACCTGCTCTTCCAAATCCCCTCTCTCC
AAGGCACACCCATATACCAAAAGGCAGAGGAGGTGCTCCGTGAACAGGGAAACCAGATTGGCGAAGCGGAGGCAG
GACCATTCGATGGTCTTGCTTCTGTGCCTTTGACCAATGGCAATTCTGTTGACTCCCCCATCGCTGATGGCTCCG
TGCGCAAGTTCCGTGCTGTTCAACTCGACCCACCTCTTCGATCTGAGCTCTACGAAGAACCGGATGAAGACATTC
AAGACAAGATTCTTTTCGTCCTTAACAATGTTTCCGAGCAGAACATTGACGAGAAACTTGAAGATCTACGAGAAG
TGTTGCGTGACCAGCACCACCAGTGGTTCGCCGCATACCTGGTGGAAGAACGTGCCAAGTTGCAGCCTAATTTCC
AGCAGCTCTATCTTGATCTTCTTGGGCGCATTGGTGACAAGATCCTCTGGGCTGAGGTCCTACGGGAGACCTATG
TTAGTGTCGCTAAGTTGATTAACTCAGAAGGCACCTTAACCTCGTCTACCGATCGCGGCCACCTGAAGAACCTTG
GTGCTTGGCTTGGCTCACTGACTATTGCCAAAGACAAACCTATTAAGCATAAGAACATCTACTTCAAGGGCTTGC
TCCTCGAAGGATACGACACTCAACGCCTCATGGTTACAATCCCCTTCACCTGCAAAGTTCTTGTGCAGGCTACCA
AATCCACAGTCTTCAAACCACCCAACCCCTGGCTGATGGATATTTTGGGCCTGCTGTTGGAGCTTTATCATTTCG
CCGAACTGAAGCTCAATCTCAAGTTTGAAATCGAAGTTCTCTGTAAAGATCTTGATCTCGACCACAAGACAATTG
AGCCGGCAATCGTCATTCGCGATCGTGCTGCACATGCCGAGGAACAACTGTCAACTGTTAACGCTCCGGAAGGTC
TTGAGCCATTTGAAGACTTGTCACTCAGCGCTATTAACCCAGCCATCCGGAATGAGAGATTGTCCCCCGCCGCCA
TCATGTCAACACTGCCAAGTCTTGACAAGATCCTTGTCCTGCCCTCATCGGCGAGCAGCATGGTCGATCCTACAA
TTCTTAAACAGATTGTGCATACTGCAGTCGAGCGCGCCATTGCCGAGATCATTACCCCCGTAGTCGAGCGTTCTG
TGACCATCGCATCCATCTCCACCGTACAACTTGTCTCCAAGGACTTTGCCATGGAACCCGATGAGGAACGCGTGC
GCCACGCCGCGGGCATCATGGTCCGACAACTTGCTGGTAGCCTGGCACTCGTCACCTGCAAAGAGCCTCTGAAGG
TTAGCATGACTAACTATATCCGCATGATTCAGCAAGAGTACTCCGAGCAGCCTATGCCCGAAGGCTTGATTCTGA
TGTGTGTCAACGATAACTTGGATGCTGCCTGTGGCATTGTCGAGAAAGCTGCAGAGGAAAAGTCCCTGCCCGAGA
TCGAGAAGGTGATTGAGCCTCAATTGGAGGCTCGTCGTCGCCATCTGGCCAGTCGTTCTAACGATCCTTTCATTG
ATCCTTCAATGAACCGTTGGGGATTGTTCATTCCGGAGCCTTACCGGCAAACGCCTGGGGGTCTCAACAAGGAGC
AACTCGCCATCTACGAAGAGTTTGCCCGTCAATCCCGAGGCCCGGCGCCATCCACTGATGCATCGGCCGGCCGTC
AACTCCCCGACGTGCTTGGAGAATCCTATCCTGCTATTCCAAACCTTTCTACCCCGGCTGAGCAGCCAGCCATTC
CTCACAGAACTCCCCAGACACAGCCTGCTGTTTCTCAAATGCCCCCAGTCCAGACTAATGGGTTCCTTGATGCTC
AAAGCCCCCGGGAAAGAGTGGAAAGCCTCGTCTCCGATCTCCAGCAGTCTGCTCGCAGCGCCCCTGAAGAACACG
TCAAGGATCTTGGCAGAGATAGTGCAGTTCTTCAAGAATACAACCAGGCACTGCGCAGCATCCTTGCCTCGACGA
ATGGAGAGGAGTTGGCGCGACTAACCTCTTTGAAGGTTTGCACCCTTTTGTATTCCCAGCCACATGGATCCCTCG
AGATTGAGGTCCTCGTGCACCTGCTTGCCAAGCTATGCGATATGTCCAGTCTCATTGCCCGGTACACGTGGGCAC
TGCTTTCCGAAGTTGATGATGAGCACATGTTCAATGTGCCGGTCACCGTTGCTCTCATCGACGCAGGCCTCCTAG
ACATCCGTCGGGTCGATACGAACCTGACCCGACTCATTCTATCTAGGAATGTTCCTGCTTTGGAGTTGCTGGGCA
ACCTGATGGATCGCGTTCTTTTCAACGAAGAACCATCGGCACTTCGATCAGACTTCTCCGGCAGTCTAGATGCTA
TGAGCCAATGGCTTGCTGAGGATGGAAGCGTTACTCCCGGTCTCGAAATCGTGCGAAAGCTGCGCGAGTCCGGTA
TTCCCGAGGTCATCAACTCTCTCCTTACAGACCAAGCTAGGTCCAAGCGAGACCAAATGGAGTACATCTTCAGCG
AGTGGATCGGTATTTACAAGGCCCCCGGTGCCACTGACCGCACCTTCCACTCTTTCCTGCAGGACCTCCACAACC
GCCAAGTGATGAACAGCCAGGAGGACTCAGCACTATTTTTCCGTCTCAGCATCGACATTTCCGTCGCCATGTTTG
AGCATGAGTCTCAGAACCCCAACGGCGGCAGCCTTGATGAGGCCTTCCTTTACATCGATGCCCTCGCTAAGCTCG
TGATTCTTCTCGTCAGATTCCAGGGCGAGACCGCTGGCGCCGTCAAAGCTAGTAAGGCTACGTACTTCAACTCTA
TTCTGTCTCTCTTGGTTCTGGTCCTCAATCACCACCAGGTCATGAGAGGAGAAGCTTTCAACCAGCGTGTATTCT
TCCGTCTCTTCTCGAGTATTCTGTGCGAGTACTCTATGAACGGCCTCCAGCACACTGAGCAGCACCAGGGAATGA
TCTTCGCCTTGGCCAACAAATTCCTCTCCTTCCAGCCCCGTTACGTGCCCGGGTTCGTTTATGGCTGGCTTTGCT
TAGTCTCTCACCGCGTGTTCATGTCTGACATGCTCAACATGCCTGATCGTGCAGGATGGGCGCCTTACTGCGAGA
TCATCCAAGCATTGCTATCCTACATGGGCGAGCAATTAAAGGCTGCCAACATTATTTACGTTGCCAAAGACCTAT
ACAAGGGCGTTCTCCGTATCTTGCTGATTCTGCACCACGATTTCCCCGAGTTCGTGGCTGAGAACCATTTCCAGT
TCTGCAATGTGATCCCGGCTCATTGCGCTCAGCTCCGCAATCTTGTTCTCAGTGCCTACCCCTCGTCGTTCCAGA
AACTTCCCGATCCTTTCCGCGAAGGATTGAAGGTCGAGCGTATCGAGGAGATGCGGGAAATTCCCAAGATCGCCG
GTGATATCGTTGCTCCTTTGCAGCTTGCCAACATCAAGGACGTTGTTGATGATGTACTCCAGAATGACAACATCT
CCGATTCTGCTGTTCAGCAGCTCTGTGACGCCATTCTTAACCCCGAATTCAAGGAAACTGGCCTCCTCTTTGTCC
CCGTCGACGTGGATGTCGTCCTAGTCAACGCGCTTGTTTTGTATATTGGCCAACAAGCTGCAGTGGAGCATGCCT
CCAAGGGCAATACCCGCAGCGCCTTTGAGAACTCGACTCACGCTGCTCTTCTGGAGAAGATCGCCCAAGTTCTGC
GTCCTGAAAGTCGCTACTACTTACTCAGTGCAATGGCCAACCAGCTCCGCTACCCCAACAGCCACACCTACTTCT
TCAGCTTCACTATTCTCCGTCTGTTTGGTGTGGATTACTCTGAGCAAGATGACTCGGATATCCGCCAACAAATCA
TTCGCGTGTTGTTGGAGCGACTGATTGTGCACCGCCCGCATCCATGGGGTCTGATCATCACCCTGCAGGAGCTCC
TCCAGAACCGGAGCTACTCATTCTTCCGCCTCCCCTTCATTCAGGCGGCACCTGAGGTAAGCTTACCACCAATCT
TCCACAGTGTCGCGATACTAAATAACTCTCTAGATCGGTCGTCTTTTCGACGCTCTTCTCCAACATATCCAACAA
CAGAGCCCTCGGCCCATCGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail