Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2186.t1
Gene name
Locationscaffold_02:1870315..1874193
Strand-
Gene length (bp)3878
Transcript length (bp)3324
Coding sequence length (bp)3324
Protein length (aa) 1108

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06775 Seipin Putative adipose-regulatory protein (Seipin) 3.8E-62 53 254
PF03133 TTL Tubulin-tyrosine ligase family 8.0E-55 794 1082
PF01975 SurE Survival protein SurE 1.7E-49 363 580

GO

GO Term Description Terminal node
GO:0036211 protein modification process Yes
GO:0019915 lipid storage Yes
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0051235 maintenance of location No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0043412 macromolecule modification No
GO:0043170 macromolecule metabolic process No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 245 267 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 30.76 18.84 42.67
5d_25C Five days - 25 degrees Celsius 33.16 20.35 45.97
7d_25C Seven days - 25 degrees Celsius 33.87 20.78 46.95
10d_25C Ten days - 25 degrees Celsius 31.74 19.42 44.06
7d_15C Seven days - 15 degrees Celsius 33.76 20.68 46.84
7d_30C Seven days - 30 degrees Celsius 34.67 21.29 48.05

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.797466 no
3d_25C 7d_25C 0.729932 no
3d_25C 7d_15C 0.738144 no
3d_25C 7d_30C 0.656544 no
3d_25C 10d_25C 0.922310 no
5d_25C 7d_25C 0.948610 no
5d_25C 7d_15C 0.957383 no
5d_25C 7d_30C 0.888443 no
5d_25C 10d_25C 0.888777 no
7d_25C 7d_15C 0.992087 no
7d_25C 7d_30C 0.943416 no
7d_25C 10d_25C 0.826723 no
7d_15C 7d_30C 0.934727 no
7d_15C 10d_25C 0.835534 no
7d_30C 10d_25C 0.759407 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2186.t1
MADSEFGDESEYGPSSVREIIMEAILAPFRALVSKSALRLYLNTLLFMGAASFLIGISAIAYGVFYFKFIPTVGL
QREVHLQFGDGNPWGTATFDSEFVALQPYDVSVTLELPRTPSNLDTGNFMLDLTLFSSRPASSLLLGPNSAPISQ
ARRPAIMTYASPLVDVARRVARMPLYVVGWRRESETLEVPMMEQLEFAKGAQNLPQSLRLEIQSYSDMQIYTARV
EFRARLTGLRWIMYYWKITSFVVFSSLFWSVSIVSAGLTWLAMTWIWGTMPKNEIKEEPQDSIKEESEDGNTSDE
SSDVKKEEPEQERRLLSSYPAEVDEAVGMTLWIIWADCDNAKRGGTFFPSILHISTTSPQMHILVTNDDGPPSNQ
SSPYVHSLVRSLQSAGHTVSVILPHQQRSWIGKAHMVGASVKPTYFRPGTLHQEDGTTHNLPRGSDGEHDEGEEW
ILIDSTPASCVQIGLYHYFKERGPVDVIVSGPNYGRNTTALFALSSGTIGAALEGACCGKRSIALSYAFSSRNHD
PVIIAEAAGHSVKLIEHLCANWADGVHLYSVNVPLEPGVSKNKVLYTDMLQNTWTSGSCFQAVDPTPADDPDLQE
EQLRNEGEMAGKQPDQIVGNSQKPSGIQHKHFKWAPSFQDVYRSVEESEPGNDGWTVKEQMTSVTPLRANFMPAP
GISGEIKLSANPPSLYSLVDCDNSYVQEMVERALTCRLGSAFKRVSSVSELPDSSAPFFQYREYERLDFEHIMSR
PSTSLSSAYIIRKALIRKHYLSNTVANWISKHPESALRHHFKPAFDFELDYAEFLDDALLEAFELNDSLAKNEDR
PDSEKEWWILKPGMSDRGQGIRIFNSEDQLREIFEEWEEDSDDESGSERNGDDANDGSAALDTGIVTSQLRHFLV
QPYIDPPLLLPSSSNRKFHIRTYVLASGSLKVYVFKEMLALFAAKGYCAPHEEYDVADLARHLTNTCFQEGGSSN
KDSVRRFWDLDHHVPGFSADWKEKIFDQICSVTGEVFEAAARGMMVHFQTLPNAFELFGVDFLVDALGNVWLLEL
NAYPDFAQTGEDLKEAVIGRLFEEVVDVAVKPFFGLGDGAGTDDMKLVADIDLGRHA*
Coding >Pro_DTO377G3_2|g2186.t1
ATGGCGGACTCAGAATTTGGAGACGAGTCCGAATATGGCCCATCTTCTGTCAGGGAAATCATCATGGAGGCGATC
CTCGCGCCGTTCCGCGCGCTGGTATCCAAGTCCGCCTTACGGCTATACCTGAACACGCTGTTGTTCATGGGCGCC
GCATCATTCCTAATAGGCATCTCCGCAATTGCCTACGGGGTTTTTTATTTTAAATTCATTCCCACGGTCGGACTA
CAACGCGAAGTCCATCTACAATTTGGCGATGGCAACCCCTGGGGTACAGCAACCTTTGACTCGGAATTTGTGGCT
CTTCAGCCCTACGACGTATCCGTGACGCTCGAGCTCCCACGCACACCCTCAAACCTCGATACAGGCAACTTCATG
CTCGACCTCACCCTCTTCTCATCCCGCCCCGCCTCATCCCTCTTACTCGGCCCGAATAGCGCCCCGATCTCGCAG
GCCCGCCGCCCTGCTATCATGACTTATGCTTCGCCGCTGGTAGATGTTGCCCGGAGAGTGGCGCGTATGCCGCTC
TATGTTGTTGGCTGGCGCCGGGAGTCGGAGACACTGGAGGTGCCGATGATGGAGCAGCTTGAGTTTGCGAAGGGG
GCGCAGAACTTGCCGCAGAGTCTGAGGCTGGAGATCCAAAGTTACTCGGACATGCAGATTTACACTGCCCGGGTG
GAGTTCCGTGCTAGGCTTACAGGGCTTAGATGGATTATGTATTATTGGAAGATTACGTCTTTTGTTGTTTTCAGC
TCTTTGTTCTGGTCGGTCTCTATTGTCTCTGCTGGCTTGACGTGGCTGGCCATGACTTGGATTTGGGGGACTATG
CCTAAGAATGAGATCAAGGAGGAGCCGCAGGACTCTATCAAAGAAGAGTCCGAGGACGGGAATACTTCTGATGAA
TCTTCCGATGTCAAAAAGGAAGAGCCCGAGCAGGAGAGGAGGTTGCTCTCAAGCTATCCGGCTGAGGTTGATGAA
GCTGTGGGAATGACATTGTGGATCATCTGGGCCGATTGCGACAACGCAAAGCGGGGGGGAACTTTCTTCCCTTCC
ATCCTTCACATCTCAACCACTTCACCCCAAATGCATATCCTGGTCACCAACGACGACGGTCCTCCGTCAAACCAG
TCATCGCCGTACGTGCATTCGCTTGTCCGCTCGCTCCAGTCCGCAGGTCATACGGTCTCGGTCATTCTACCACAC
CAGCAACGATCATGGATAGGTAAAGCGCACATGGTAGGCGCCTCTGTCAAACCTACCTACTTCCGGCCCGGCACG
CTCCATCAAGAAGACGGGACAACACACAACCTGCCCCGTGGCAGTGATGGTGAACACGACGAAGGCGAAGAGTGG
ATTTTGATCGACTCAACTCCCGCGAGCTGTGTCCAGATCGGCCTATACCACTACTTCAAAGAACGTGGCCCTGTC
GATGTGATTGTCTCCGGTCCGAACTATGGTCGCAACACAACGGCATTATTCGCATTGTCGAGCGGAACCATTGGC
GCAGCGTTGGAAGGTGCCTGCTGTGGCAAGCGCTCAATTGCTCTGTCGTATGCTTTCAGCTCTCGAAACCATGAC
CCTGTTATCATCGCAGAGGCCGCGGGCCATTCAGTCAAGTTGATTGAGCATCTTTGCGCGAACTGGGCAGATGGG
GTGCACCTCTATAGCGTCAATGTTCCCCTCGAACCCGGCGTTAGTAAGAACAAGGTCTTATATACCGACATGCTG
CAGAACACGTGGACATCCGGGAGTTGCTTCCAGGCTGTCGACCCCACACCCGCAGACGACCCTGATTTGCAAGAA
GAGCAACTACGCAACGAAGGCGAAATGGCAGGAAAGCAACCAGATCAGATTGTCGGTAACAGCCAGAAGCCATCC
GGAATTCAGCACAAGCATTTCAAGTGGGCACCGAGTTTCCAGGATGTTTACCGAAGTGTGGAGGAAAGTGAGCCT
GGCAATGATGGCTGGACTGTTAAGGAGCAAATGACTAGCGTCACGCCCCTCAGGGCCAATTTCATGCCCGCGCCC
GGTATTTCGGGGGAGATTAAGCTATCGGCTAATCCGCCCTCGTTGTACTCCCTCGTCGACTGCGATAACTCCTAC
GTGCAAGAAATGGTTGAACGGGCATTAACATGTCGCCTGGGAAGTGCCTTCAAGCGTGTGTCTTCTGTGTCCGAG
CTGCCGGACTCATCTGCGCCATTTTTCCAGTACCGGGAATATGAGCGCCTCGATTTCGAGCATATCATGTCCAGG
CCCTCGACGTCTCTTTCAAGCGCGTACATCATCCGGAAAGCTTTAATTCGCAAGCACTATCTCTCAAACACAGTG
GCCAATTGGATCTCGAAACACCCAGAGAGCGCTCTTCGACACCACTTCAAGCCCGCCTTCGACTTCGAACTCGAT
TATGCCGAATTCCTCGACGACGCCCTGCTAGAAGCATTCGAGTTGAACGACAGCTTAGCTAAGAACGAAGATCGA
CCTGACTCCGAAAAGGAATGGTGGATCCTCAAGCCCGGCATGAGCGATCGAGGCCAGGGAATCCGCATCTTCAAC
AGCGAAGACCAGCTACGCGAGATCTTCGAGGAGTGGGAAGAAGACTCAGACGACGAGAGCGGATCCGAGAGAAAT
GGCGACGACGCGAATGACGGCAGCGCCGCCCTAGACACAGGGATCGTCACTTCGCAGCTCCGCCACTTCCTCGTA
CAGCCCTATATTGACCCACCTCTCCTCCTCCCGTCATCCTCAAACCGTAAATTCCACATCCGCACCTATGTCCTC
GCCTCGGGATCACTCAAAGTCTACGTCTTCAAGGAGATGCTCGCGCTCTTCGCTGCGAAGGGCTACTGCGCTCCG
CATGAAGAGTACGACGTCGCCGACCTCGCGCGCCATCTGACCAACACCTGTTTCCAGGAAGGCGGCAGCTCGAAC
AAGGATAGTGTGCGCCGCTTCTGGGATCTCGACCACCACGTCCCCGGTTTCAGTGCAGACTGGAAGGAGAAGATC
TTTGATCAGATCTGCTCGGTGACCGGTGAGGTGTTTGAGGCTGCGGCCCGCGGTATGATGGTTCATTTCCAGACT
CTGCCCAATGCGTTTGAGCTGTTTGGTGTTGATTTCCTCGTTGACGCTCTTGGGAATGTGTGGCTGCTGGAGCTC
AACGCGTACCCGGATTTCGCGCAGACTGGTGAGGATCTGAAGGAGGCTGTTATTGGGCGTTTGTTTGAGGAGGTG
GTTGATGTTGCTGTCAAGCCGTTCTTTGGGCTGGGTGACGGGGCTGGTACTGATGATATGAAGCTGGTTGCTGAT
ATTGATCTCGGCAGACATGCTTAA
Transcript >Pro_DTO377G3_2|g2186.t1
ATGGCGGACTCAGAATTTGGAGACGAGTCCGAATATGGCCCATCTTCTGTCAGGGAAATCATCATGGAGGCGATC
CTCGCGCCGTTCCGCGCGCTGGTATCCAAGTCCGCCTTACGGCTATACCTGAACACGCTGTTGTTCATGGGCGCC
GCATCATTCCTAATAGGCATCTCCGCAATTGCCTACGGGGTTTTTTATTTTAAATTCATTCCCACGGTCGGACTA
CAACGCGAAGTCCATCTACAATTTGGCGATGGCAACCCCTGGGGTACAGCAACCTTTGACTCGGAATTTGTGGCT
CTTCAGCCCTACGACGTATCCGTGACGCTCGAGCTCCCACGCACACCCTCAAACCTCGATACAGGCAACTTCATG
CTCGACCTCACCCTCTTCTCATCCCGCCCCGCCTCATCCCTCTTACTCGGCCCGAATAGCGCCCCGATCTCGCAG
GCCCGCCGCCCTGCTATCATGACTTATGCTTCGCCGCTGGTAGATGTTGCCCGGAGAGTGGCGCGTATGCCGCTC
TATGTTGTTGGCTGGCGCCGGGAGTCGGAGACACTGGAGGTGCCGATGATGGAGCAGCTTGAGTTTGCGAAGGGG
GCGCAGAACTTGCCGCAGAGTCTGAGGCTGGAGATCCAAAGTTACTCGGACATGCAGATTTACACTGCCCGGGTG
GAGTTCCGTGCTAGGCTTACAGGGCTTAGATGGATTATGTATTATTGGAAGATTACGTCTTTTGTTGTTTTCAGC
TCTTTGTTCTGGTCGGTCTCTATTGTCTCTGCTGGCTTGACGTGGCTGGCCATGACTTGGATTTGGGGGACTATG
CCTAAGAATGAGATCAAGGAGGAGCCGCAGGACTCTATCAAAGAAGAGTCCGAGGACGGGAATACTTCTGATGAA
TCTTCCGATGTCAAAAAGGAAGAGCCCGAGCAGGAGAGGAGGTTGCTCTCAAGCTATCCGGCTGAGGTTGATGAA
GCTGTGGGAATGACATTGTGGATCATCTGGGCCGATTGCGACAACGCAAAGCGGGGGGGAACTTTCTTCCCTTCC
ATCCTTCACATCTCAACCACTTCACCCCAAATGCATATCCTGGTCACCAACGACGACGGTCCTCCGTCAAACCAG
TCATCGCCGTACGTGCATTCGCTTGTCCGCTCGCTCCAGTCCGCAGGTCATACGGTCTCGGTCATTCTACCACAC
CAGCAACGATCATGGATAGGTAAAGCGCACATGGTAGGCGCCTCTGTCAAACCTACCTACTTCCGGCCCGGCACG
CTCCATCAAGAAGACGGGACAACACACAACCTGCCCCGTGGCAGTGATGGTGAACACGACGAAGGCGAAGAGTGG
ATTTTGATCGACTCAACTCCCGCGAGCTGTGTCCAGATCGGCCTATACCACTACTTCAAAGAACGTGGCCCTGTC
GATGTGATTGTCTCCGGTCCGAACTATGGTCGCAACACAACGGCATTATTCGCATTGTCGAGCGGAACCATTGGC
GCAGCGTTGGAAGGTGCCTGCTGTGGCAAGCGCTCAATTGCTCTGTCGTATGCTTTCAGCTCTCGAAACCATGAC
CCTGTTATCATCGCAGAGGCCGCGGGCCATTCAGTCAAGTTGATTGAGCATCTTTGCGCGAACTGGGCAGATGGG
GTGCACCTCTATAGCGTCAATGTTCCCCTCGAACCCGGCGTTAGTAAGAACAAGGTCTTATATACCGACATGCTG
CAGAACACGTGGACATCCGGGAGTTGCTTCCAGGCTGTCGACCCCACACCCGCAGACGACCCTGATTTGCAAGAA
GAGCAACTACGCAACGAAGGCGAAATGGCAGGAAAGCAACCAGATCAGATTGTCGGTAACAGCCAGAAGCCATCC
GGAATTCAGCACAAGCATTTCAAGTGGGCACCGAGTTTCCAGGATGTTTACCGAAGTGTGGAGGAAAGTGAGCCT
GGCAATGATGGCTGGACTGTTAAGGAGCAAATGACTAGCGTCACGCCCCTCAGGGCCAATTTCATGCCCGCGCCC
GGTATTTCGGGGGAGATTAAGCTATCGGCTAATCCGCCCTCGTTGTACTCCCTCGTCGACTGCGATAACTCCTAC
GTGCAAGAAATGGTTGAACGGGCATTAACATGTCGCCTGGGAAGTGCCTTCAAGCGTGTGTCTTCTGTGTCCGAG
CTGCCGGACTCATCTGCGCCATTTTTCCAGTACCGGGAATATGAGCGCCTCGATTTCGAGCATATCATGTCCAGG
CCCTCGACGTCTCTTTCAAGCGCGTACATCATCCGGAAAGCTTTAATTCGCAAGCACTATCTCTCAAACACAGTG
GCCAATTGGATCTCGAAACACCCAGAGAGCGCTCTTCGACACCACTTCAAGCCCGCCTTCGACTTCGAACTCGAT
TATGCCGAATTCCTCGACGACGCCCTGCTAGAAGCATTCGAGTTGAACGACAGCTTAGCTAAGAACGAAGATCGA
CCTGACTCCGAAAAGGAATGGTGGATCCTCAAGCCCGGCATGAGCGATCGAGGCCAGGGAATCCGCATCTTCAAC
AGCGAAGACCAGCTACGCGAGATCTTCGAGGAGTGGGAAGAAGACTCAGACGACGAGAGCGGATCCGAGAGAAAT
GGCGACGACGCGAATGACGGCAGCGCCGCCCTAGACACAGGGATCGTCACTTCGCAGCTCCGCCACTTCCTCGTA
CAGCCCTATATTGACCCACCTCTCCTCCTCCCGTCATCCTCAAACCGTAAATTCCACATCCGCACCTATGTCCTC
GCCTCGGGATCACTCAAAGTCTACGTCTTCAAGGAGATGCTCGCGCTCTTCGCTGCGAAGGGCTACTGCGCTCCG
CATGAAGAGTACGACGTCGCCGACCTCGCGCGCCATCTGACCAACACCTGTTTCCAGGAAGGCGGCAGCTCGAAC
AAGGATAGTGTGCGCCGCTTCTGGGATCTCGACCACCACGTCCCCGGTTTCAGTGCAGACTGGAAGGAGAAGATC
TTTGATCAGATCTGCTCGGTGACCGGTGAGGTGTTTGAGGCTGCGGCCCGCGGTATGATGGTTCATTTCCAGACT
CTGCCCAATGCGTTTGAGCTGTTTGGTGTTGATTTCCTCGTTGACGCTCTTGGGAATGTGTGGCTGCTGGAGCTC
AACGCGTACCCGGATTTCGCGCAGACTGGTGAGGATCTGAAGGAGGCTGTTATTGGGCGTTTGTTTGAGGAGGTG
GTTGATGTTGCTGTCAAGCCGTTCTTTGGGCTGGGTGACGGGGCTGGTACTGATGATATGAAGCTGGTTGCTGAT
ATTGATCTCGGCAGACATGCTTAA
Gene >Pro_DTO377G3_2|g2186.t1
ATGGCGGACTCAGAATTTGGAGACGAGTCCGAATATGGCCCATCTTCTGTCAGGGAAATCATCATGGTGGGTGTA
TTGATGCATATTTCTCAGCTGCAACTGACACAAGACAGGAGGCGATCCTCGCGCCGTTCCGCGCGCTGGTATCCA
AGTCCGCCTTACGGCTATACCTGAACACGCTGTTGTTCATGGGCGCCGCATCATTCCTAATAGGCATCTCCGCAA
TTGCCTACGGGGTTTTTTATTTTAAATTCATTCCCACGGTCGGACTACAACGCGAAGTCCATCTACAATTTGGGT
ATAACAACATTCCCCACAAAGACACCCAGCTCAACTAACTTGTGCAAGCGATGGCAACCCCTGGGGTACAGCAAC
CTTTGACTCGGAATTTGTGGCTCTTCAGCCCTACGACGTATCCGTGACGCTCGAGCTCCCACGCACACCCTCAAA
CCTCGATACAGGCAACTTCATGCTCGACCTCACCCTCTTCTCATCCCGCCCCGCCTCATCCCTCTTACTCGGCCC
GAATAGCGCCCCGATCTCGCAGGCCCGCCGCCCTGCTATCATGACTTATGCTTCGCCGCTGGTAGATGTTGCCCG
GAGAGTGGCGCGTATGCCGCTCTATGTTGTTGGCTGGCGCCGGGAGTCGGAGACACTGGAGGTGCCGATGATGGA
GCAGCTTGAGTTTGCGAAGGGGGCGCAGAACTTGCCGCAGAGTCTGAGGCTGGAGATCCAAAGTTACTCGGACAT
GCAGATTTACACTGCCCGGGTGGAGTTCCGTGCTAGGCTTACAGGGCTTAGGTAGGTCTTCTTGGGGATTAGGTG
GTTTGTGGGATATGGCTAACAGATGATAGATGGATTATGTATTATTGGAAGATTACGTCTTTTGTTGTTTTCAGC
TCTTTGTTCTGGTCGGTCTCTATTGTCTCTGCTGGCTTGACGTGGCTGGCCATGACTTGGATTTGGGGGACTATG
CCTAAGAATGAGATCAAGGAGGAGCCGCAGGACTCTATCAAAGAAGAGTCCGAGGACGGGAATACTTCTGATGAA
TCTTCCGATGTCAAAAAGGAAGAGCCCGAGCAGGAGAGGAGGTTGCTCTCAAGCTATCCGGCTGAGGTTGATGAA
GCTGGTACAGGCTCTGGACTAGAAAGCGCAGAAGCTCGTGGAGTACAGAGACGGCGCAGTCATTTGACACAATCA
CAATGATGTGTTTTCATTGGCCTAGCTGAGCTGAATGGTACTATATGTTGTAATGTCTTATGATAGTGGGAATGA
CATTGTGGATCATCTGGGCCGATTGCGACAACGCAAAGCGGGGGGGAACTTTCTTCCCTTCCATCCTTCACATCT
CAACCACTTCACCCCAAATGCATATCCTGGTAAGCAGATATAGATACTGCAATGTCAGCTTGAAGACTTATCTCT
ATCTAGGTCACCAACGACGACGGTCCTCCGTCAAACCAGTCATCGCCGTACGTGCATTCGCTTGTCCGCTCGCTC
CAGTCCGCAGGTCATACGGTCTCGGTCATTCTACCACACCAGCAACGATCATGGATAGGTAAAGCGCACATGGTA
GGCGCCTCTGTCAAACCTACCTACTTCCGGCCCGGCACGCTCCATCAAGAAGACGGGACAACACACAACCTGCCC
CGTGGCAGTGATGGTGAACACGACGAAGGCGAAGAGTGGATTTTGATCGACTCAACTCCCGCGAGCTGTGTCCAG
ATCGGCCTATACCACTACTTCAAAGAACGTGGCCCTGTCGATGTGATTGTCTCCGGTCCGAACTATGGTCGCAAC
ACAACGGCATTATTCGCATTGTCGAGCGGAACCATTGGCGCAGCGTTGGAAGGTGCCTGCTGTGGCAAGCGCTCA
ATTGCTCTGTCGTATGCTTTCAGCTCTCGAAACCATGACCCTGTTATCATCGCAGAGGCCGCGGGCCATTCAGTC
AAGTTGATTGAGCATCTTTGCGCGAACTGGGCAGATGGGGTGCACCTCTATAGCGTCAATGTTCCCCTCGAACCC
GGCGTTAGTAAGAACAAGGTCTTATATACCGACATGCTGCAGAACACGTGGACATCCGGGAGTTGCTTCCAGGCT
GTCGACCCCACACCCGCAGACGACCCTGATTTGCAAGAAGAGCAACTACGCAACGAAGGCGAAATGGCAGGAAAG
CAACCAGATCAGATTGTCGGTAACAGCCAGAAGCCATCCGGAATTCAGCACAAGCATTTCAAGTGGGCACCGAGT
TTCCAGGATGTTTACCGAAGTGTGGAGGAAAGTGAGCCTGGCAATGATGGCTGGACTGTTAAGGAGCAAATGACT
AGGTTTGTTCAATGCCCTCTTACTTTTGGACATCGACTGACTTTTACAGCGTCACGCCCCTCAGGGCCAATTTCA
TGCCCGCGCCCGGTATTTCGGGGGAGATTAAGCTGTGAGTGACGACTTTGACGCCATGCATGGTATGGAGGGTTC
TATCCGAAATCTATATGTTGCACCCACCTTAGATATCTGGCTTAGCTGTTAGATACTATATCCCCTCCCCTTTGA
TTTGATTTTCTTTAAGTATTGGCACCCTTTCTGATAGACGGAGATCTTGTAGATCGGCTAATCCGCCCTCGTTGT
ACTCCCTCGTCGACTGCGATAACTCCTACGTGCAAGAAATGGTTGAACGGGCATTAACATGTCGCCTGGGAAGTG
CCTTCAAGCGTGTGTCTTCTGTGTCCGAGCTGCCGGACTCATCTGCGCCATTTTTCCAGTACCGGGAATATGAGC
GCCTCGATTTCGAGCATATCATGTCCAGGCCCTCGACGTCTCTTTCAAGCGCGTACATCATCCGGAAAGCTTTAA
TTCGCAAGCACTATCTCTCAAACACAGTGGCCAATTGGATCTCGAAACACCCAGAGAGCGCTCTTCGACACCACT
TCAAGCCCGCCTTCGACTTCGAACTCGATTATGCCGAATTCCTCGACGACGCCCTGCTAGAAGCATTCGAGTTGA
ACGACAGCTTAGCTAAGAACGAAGATCGACCTGACTCCGAAAAGGAATGGTGGATCCTCAAGCCCGGCATGAGCG
ATCGAGGCCAGGGAATCCGCATCTTCAACAGCGAAGACCAGCTACGCGAGATCTTCGAGGAGTGGGAAGAAGACT
CAGACGACGAGAGCGGATCCGAGAGAAATGGCGACGACGCGAATGACGGCAGCGCCGCCCTAGACACAGGGATCG
TCACTTCGCAGCTCCGCCACTTCCTCGTACAGCCCTATATTGACCCACCTCTCCTCCTCCCGTCATCCTCAAACC
GTAAATTCCACATCCGCACCTATGTCCTCGCCTCGGGATCACTCAAAGTCTACGTCTTCAAGGAGATGCTCGCGC
TCTTCGCTGCGAAGGGCTACTGCGCTCCGCATGAAGAGTACGACGTCGCCGACCTCGCGCGCCATCTGACCAACA
CCTGTTTCCAGGAAGGCGGCAGCTCGAACAAGGATAGTGTGCGCCGCTTCTGGGATCTCGACCACCACGTCCCCG
GTTTCAGTGCAGACTGGAAGGAGAAGATCTTTGATCAGATCTGCTCGGTGACCGGTGAGGTGTTTGAGGCTGCGG
CCCGCGGTATGATGGTTCATTTCCAGACTCTGCCCAATGCGTTTGAGCTGTTTGGTGTTGATTTCCTCGTTGACG
CTCTTGGGAATGTGTGGCTGCTGGAGCTCAACGCGTACCCGGATTTCGCGCAGACTGGTGAGGATCTGAAGGAGG
CTGTTATTGGGCGTTTGTTTGAGGAGGTGGTTGATGTTGCTGTCAAGCCGTTCTTTGGGCTGGGTGACGGGGCTG
GTACTGATGATATGAAGCTGGTTGCTGATATTGATCTCGGCAGACATGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail