Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2182.t1
Gene name
Locationscaffold_02:1863212..1865470
Strand-
Gene length (bp)2258
Transcript length (bp)2202
Coding sequence length (bp)2202
Protein length (aa) 734

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03801 Ndc80_HEC HEC/Ndc80p family 2.0E-59 120 281

GO

GO Term Description Terminal node
GO:0031262 Ndc80 complex Yes
GO:0051315 attachment of mitotic spindle microtubules to kinetochore Yes
GO:0022402 cell cycle process No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0009987 cellular process No
GO:0008608 attachment of spindle microtubules to kinetochore No
GO:1903047 mitotic cell cycle process No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2182.t1
MSQDTGLFSIKRPRETLGSVQNFSAIPQPQSALKRASSIGFQNPPFSSQNHRSSLMGSTSRPQQPNFTRMSIGGP
YGADAGLSSVRRSVSSNMFNGASASRQSYAPGSLSSIPAPPQNPQRRSSVFSRPSTGGGPMGHQSFFTQVPNVAG
VPRDPRPLRDRSFQARIGQELLEYLTIHGFELEMKHSLGQNTLRSPTQKDFNLIFQWLYHRIDPGYKFQKAMDSE
VPPILKQLRYPYEKGITKSQIAAVGGQNWSTFLGMLHWLMQLAQMMDRYQSGEYDDACAEAGVDVTGDRIIFRFL
TQAYHDWLQGGEDEDDDTAEKRLIPHVENMSREFALGNERYVQELEALEAENRALRDQIEEVEKSAPDIAKLDKH
FRILEDDKRKFEDYNQNVKGKIEKYETRIKFLDTEIEKTDTDLQATESERSELQASVDRQGITIQDIDRMNSERE
RLQKNLEDTVARLEEAHVRVMEKEAEASQKLEDLEQIVKAYNTLGYQTSLIPAAAENAKGQDYELTLNINESNFS
VSQIGGPANPISPEGDRLLAEPFTGYHPAHLLNLDLRGSVRNSLQSLRKEINERRKQGIDDDLDRRNLLDNIKEA
MDEKRSEVEALEHRRRAAEEEFERTKEITTTQKLASDAQIEKMEKELAKMRATLSDSVQLMEQREMNTNIEYEQL
TLRANSLREELHTNVETMLNDVIRFKVHVQKGLEDYESFVVDEVEQELGEEEVLEEEL*
Coding >Pro_DTO377G3_2|g2182.t1
ATGTCGCAAGATACTGGGCTTTTCAGTATTAAGCGCCCCCGAGAGACTCTCGGGAGTGTTCAAAATTTCTCCGCC
ATCCCTCAACCGCAATCGGCACTGAAGCGCGCAAGCTCTATCGGATTCCAAAACCCCCCGTTCAGCTCTCAGAAC
CACCGAAGTTCATTGATGGGCTCCACCAGTCGCCCACAGCAGCCAAATTTTACACGCATGTCAATTGGTGGACCA
TATGGCGCTGATGCCGGTCTCTCATCTGTTCGCCGATCAGTGTCGAGTAACATGTTCAATGGAGCCAGTGCCAGT
CGGCAGAGCTACGCGCCAGGGTCTCTTTCCTCCATTCCTGCACCGCCTCAAAACCCACAGCGCAGAAGTAGTGTG
TTTTCGCGACCATCCACGGGAGGAGGGCCGATGGGACATCAATCGTTCTTCACTCAAGTTCCCAACGTGGCTGGG
GTTCCCAGAGACCCGCGCCCTCTCAGAGACCGATCTTTCCAGGCACGGATTGGCCAGGAATTGTTGGAGTATTTG
ACTATTCATGGCTTTGAGTTGGAAATGAAACATTCCTTGGGCCAGAACACTCTTCGCTCACCGACCCAGAAGGAT
TTCAACCTTATCTTCCAGTGGCTATATCATCGGATCGATCCAGGATACAAGTTTCAGAAAGCGATGGACTCCGAA
GTACCGCCAATCCTAAAACAGCTAAGATACCCATATGAGAAAGGCATTACGAAGTCACAAATCGCAGCCGTTGGT
GGCCAGAACTGGTCGACCTTCCTCGGAATGCTACATTGGTTGATGCAATTGGCACAGATGATGGATCGCTATCAG
TCAGGCGAGTATGATGATGCCTGCGCCGAGGCGGGTGTCGATGTCACCGGTGATCGCATTATTTTCCGGTTCCTC
ACTCAAGCATATCACGATTGGCTACAGGGTGGTGAAGACGAGGATGATGACACCGCCGAGAAGCGGTTAATCCCG
CACGTTGAAAACATGTCGCGAGAATTTGCTCTTGGCAACGAACGGTACGTGCAGGAACTGGAGGCACTAGAGGCG
GAGAACCGGGCTCTTCGTGATCAAATTGAAGAAGTGGAGAAGAGTGCTCCCGACATTGCCAAGTTGGATAAACAC
TTCCGTATCTTGGAGGATGACAAGAGGAAATTTGAGGATTATAATCAAAACGTCAAAGGCAAAATCGAAAAATAC
GAGACTCGCATCAAATTCCTCGACACGGAGATCGAGAAAACTGATACCGATCTCCAGGCCACTGAATCTGAGCGT
TCCGAACTACAGGCAAGTGTTGATCGCCAAGGCATCACTATTCAGGATATCGACCGCATGAACTCGGAGCGAGAA
CGTCTACAGAAGAATCTCGAAGATACCGTAGCTCGCCTCGAAGAGGCCCATGTCCGTGTCATGGAGAAGGAGGCG
GAAGCTAGCCAGAAACTGGAAGATCTGGAACAGATCGTGAAGGCTTATAATACTCTTGGCTACCAGACTAGCTTG
ATTCCCGCAGCTGCTGAGAACGCCAAGGGCCAAGATTATGAGCTTACCCTGAATATTAATGAGAGCAATTTCTCT
GTGAGCCAAATTGGTGGCCCTGCCAACCCAATCTCTCCCGAGGGGGATCGCTTATTGGCGGAGCCTTTCACTGGC
TACCACCCGGCGCATTTGCTCAATTTGGATCTACGAGGCTCTGTCCGAAACAGCCTGCAATCCCTCCGGAAAGAG
ATCAATGAACGACGGAAGCAAGGGATCGATGATGACCTTGACCGTCGCAATCTACTCGACAACATTAAAGAGGCA
ATGGATGAGAAACGGAGCGAGGTCGAGGCTTTGGAGCATCGACGCCGGGCAGCAGAGGAAGAGTTTGAACGAACA
AAAGAAATCACGACGACTCAGAAGCTGGCCTCCGATGCCCAAATTGAGAAAATGGAGAAGGAATTGGCAAAGATG
CGCGCTACGCTCAGCGACAGTGTTCAATTGATGGAGCAGCGCGAGATGAACACCAATATCGAATACGAACAACTG
ACGCTTCGGGCAAATTCCCTCCGAGAGGAGTTGCATACTAACGTCGAAACGATGCTTAATGACGTGATTCGCTTC
AAAGTACATGTTCAAAAAGGTCTTGAAGACTACGAGAGCTTTGTCGTCGACGAAGTGGAACAAGAGCTTGGCGAA
GAAGAAGTTCTTGAGGAGGAGCTTTGA
Transcript >Pro_DTO377G3_2|g2182.t1
ATGTCGCAAGATACTGGGCTTTTCAGTATTAAGCGCCCCCGAGAGACTCTCGGGAGTGTTCAAAATTTCTCCGCC
ATCCCTCAACCGCAATCGGCACTGAAGCGCGCAAGCTCTATCGGATTCCAAAACCCCCCGTTCAGCTCTCAGAAC
CACCGAAGTTCATTGATGGGCTCCACCAGTCGCCCACAGCAGCCAAATTTTACACGCATGTCAATTGGTGGACCA
TATGGCGCTGATGCCGGTCTCTCATCTGTTCGCCGATCAGTGTCGAGTAACATGTTCAATGGAGCCAGTGCCAGT
CGGCAGAGCTACGCGCCAGGGTCTCTTTCCTCCATTCCTGCACCGCCTCAAAACCCACAGCGCAGAAGTAGTGTG
TTTTCGCGACCATCCACGGGAGGAGGGCCGATGGGACATCAATCGTTCTTCACTCAAGTTCCCAACGTGGCTGGG
GTTCCCAGAGACCCGCGCCCTCTCAGAGACCGATCTTTCCAGGCACGGATTGGCCAGGAATTGTTGGAGTATTTG
ACTATTCATGGCTTTGAGTTGGAAATGAAACATTCCTTGGGCCAGAACACTCTTCGCTCACCGACCCAGAAGGAT
TTCAACCTTATCTTCCAGTGGCTATATCATCGGATCGATCCAGGATACAAGTTTCAGAAAGCGATGGACTCCGAA
GTACCGCCAATCCTAAAACAGCTAAGATACCCATATGAGAAAGGCATTACGAAGTCACAAATCGCAGCCGTTGGT
GGCCAGAACTGGTCGACCTTCCTCGGAATGCTACATTGGTTGATGCAATTGGCACAGATGATGGATCGCTATCAG
TCAGGCGAGTATGATGATGCCTGCGCCGAGGCGGGTGTCGATGTCACCGGTGATCGCATTATTTTCCGGTTCCTC
ACTCAAGCATATCACGATTGGCTACAGGGTGGTGAAGACGAGGATGATGACACCGCCGAGAAGCGGTTAATCCCG
CACGTTGAAAACATGTCGCGAGAATTTGCTCTTGGCAACGAACGGTACGTGCAGGAACTGGAGGCACTAGAGGCG
GAGAACCGGGCTCTTCGTGATCAAATTGAAGAAGTGGAGAAGAGTGCTCCCGACATTGCCAAGTTGGATAAACAC
TTCCGTATCTTGGAGGATGACAAGAGGAAATTTGAGGATTATAATCAAAACGTCAAAGGCAAAATCGAAAAATAC
GAGACTCGCATCAAATTCCTCGACACGGAGATCGAGAAAACTGATACCGATCTCCAGGCCACTGAATCTGAGCGT
TCCGAACTACAGGCAAGTGTTGATCGCCAAGGCATCACTATTCAGGATATCGACCGCATGAACTCGGAGCGAGAA
CGTCTACAGAAGAATCTCGAAGATACCGTAGCTCGCCTCGAAGAGGCCCATGTCCGTGTCATGGAGAAGGAGGCG
GAAGCTAGCCAGAAACTGGAAGATCTGGAACAGATCGTGAAGGCTTATAATACTCTTGGCTACCAGACTAGCTTG
ATTCCCGCAGCTGCTGAGAACGCCAAGGGCCAAGATTATGAGCTTACCCTGAATATTAATGAGAGCAATTTCTCT
GTGAGCCAAATTGGTGGCCCTGCCAACCCAATCTCTCCCGAGGGGGATCGCTTATTGGCGGAGCCTTTCACTGGC
TACCACCCGGCGCATTTGCTCAATTTGGATCTACGAGGCTCTGTCCGAAACAGCCTGCAATCCCTCCGGAAAGAG
ATCAATGAACGACGGAAGCAAGGGATCGATGATGACCTTGACCGTCGCAATCTACTCGACAACATTAAAGAGGCA
ATGGATGAGAAACGGAGCGAGGTCGAGGCTTTGGAGCATCGACGCCGGGCAGCAGAGGAAGAGTTTGAACGAACA
AAAGAAATCACGACGACTCAGAAGCTGGCCTCCGATGCCCAAATTGAGAAAATGGAGAAGGAATTGGCAAAGATG
CGCGCTACGCTCAGCGACAGTGTTCAATTGATGGAGCAGCGCGAGATGAACACCAATATCGAATACGAACAACTG
ACGCTTCGGGCAAATTCCCTCCGAGAGGAGTTGCATACTAACGTCGAAACGATGCTTAATGACGTGATTCGCTTC
AAAGTACATGTTCAAAAAGGTCTTGAAGACTACGAGAGCTTTGTCGTCGACGAAGTGGAACAAGAGCTTGGCGAA
GAAGAAGTTCTTGAGGAGGAGCTTTGA
Gene >Pro_DTO377G3_2|g2182.t1
ATGTCGCAAGATACTGGGCTTTTCAGTATTAAGCGCCCCCGAGAGGTATAGATCCCCCCTATCTAGCGCAAGACT
TGAGGCTAATTTATATTGCGATCAAGACTCTCGGGAGTGTTCAAAATTTCTCCGCCATCCCTCAACCGCAATCGG
CACTGAAGCGCGCAAGCTCTATCGGATTCCAAAACCCCCCGTTCAGCTCTCAGAACCACCGAAGTTCATTGATGG
GCTCCACCAGTCGCCCACAGCAGCCAAATTTTACACGCATGTCAATTGGTGGACCATATGGCGCTGATGCCGGTC
TCTCATCTGTTCGCCGATCAGTGTCGAGTAACATGTTCAATGGAGCCAGTGCCAGTCGGCAGAGCTACGCGCCAG
GGTCTCTTTCCTCCATTCCTGCACCGCCTCAAAACCCACAGCGCAGAAGTAGTGTGTTTTCGCGACCATCCACGG
GAGGAGGGCCGATGGGACATCAATCGTTCTTCACTCAAGTTCCCAACGTGGCTGGGGTTCCCAGAGACCCGCGCC
CTCTCAGAGACCGATCTTTCCAGGCACGGATTGGCCAGGAATTGTTGGAGTATTTGACTATTCATGGCTTTGAGT
TGGAAATGAAACATTCCTTGGGCCAGAACACTCTTCGCTCACCGACCCAGAAGGATTTCAACCTTATCTTCCAGT
GGCTATATCATCGGATCGATCCAGGATACAAGTTTCAGAAAGCGATGGACTCCGAAGTACCGCCAATCCTAAAAC
AGCTAAGATACCCATATGAGAAAGGCATTACGAAGTCACAAATCGCAGCCGTTGGTGGCCAGAACTGGTCGACCT
TCCTCGGAATGCTACATTGGTTGATGCAATTGGCACAGATGATGGATCGCTATCAGTCAGGCGAGTATGATGATG
CCTGCGCCGAGGCGGGTGTCGATGTCACCGGTGATCGCATTATTTTCCGGTTCCTCACTCAAGCATATCACGATT
GGCTACAGGGTGGTGAAGACGAGGATGATGACACCGCCGAGAAGCGGTTAATCCCGCACGTTGAAAACATGTCGC
GAGAATTTGCTCTTGGCAACGAACGGTACGTGCAGGAACTGGAGGCACTAGAGGCGGAGAACCGGGCTCTTCGTG
ATCAAATTGAAGAAGTGGAGAAGAGTGCTCCCGACATTGCCAAGTTGGATAAACACTTCCGTATCTTGGAGGATG
ACAAGAGGAAATTTGAGGATTATAATCAAAACGTCAAAGGCAAAATCGAAAAATACGAGACTCGCATCAAATTCC
TCGACACGGAGATCGAGAAAACTGATACCGATCTCCAGGCCACTGAATCTGAGCGTTCCGAACTACAGGCAAGTG
TTGATCGCCAAGGCATCACTATTCAGGATATCGACCGCATGAACTCGGAGCGAGAACGTCTACAGAAGAATCTCG
AAGATACCGTAGCTCGCCTCGAAGAGGCCCATGTCCGTGTCATGGAGAAGGAGGCGGAAGCTAGCCAGAAACTGG
AAGATCTGGAACAGATCGTGAAGGCTTATAATACTCTTGGCTACCAGACTAGCTTGATTCCCGCAGCTGCTGAGA
ACGCCAAGGGCCAAGATTATGAGCTTACCCTGAATATTAATGAGAGCAATTTCTCTGTGAGCCAAATTGGTGGCC
CTGCCAACCCAATCTCTCCCGAGGGGGATCGCTTATTGGCGGAGCCTTTCACTGGCTACCACCCGGCGCATTTGC
TCAATTTGGATCTACGAGGCTCTGTCCGAAACAGCCTGCAATCCCTCCGGAAAGAGATCAATGAACGACGGAAGC
AAGGGATCGATGATGACCTTGACCGTCGCAATCTACTCGACAACATTAAAGAGGCAATGGATGAGAAACGGAGCG
AGGTCGAGGCTTTGGAGCATCGACGCCGGGCAGCAGAGGAAGAGTTTGAACGAACAAAAGAAATCACGACGACTC
AGAAGCTGGCCTCCGATGCCCAAATTGAGAAAATGGAGAAGGAATTGGCAAAGATGCGCGCTACGCTCAGCGACA
GTGTTCAATTGATGGAGCAGCGCGAGATGAACACCAATATCGAATACGAACAACTGACGCTTCGGGCAAATTCCC
TCCGAGAGGAGTTGCATACTAACGTCGAAACGATGCTTAATGACGTGATTCGCTTCAAAGTACATGTTCAAAAAG
GTCTTGAAGACTACGAGAGCTTTGTCGTCGACGAAGTGGAACAAGAGCTTGGCGAAGAAGAAGTTCTTGAGGAGG
AGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail