Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2150.t1
Gene name
Locationscaffold_02:1779746..1780674
Strand-
Gene length (bp)928
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04281 Tom22 Mitochondrial import receptor subunit Tom22 1.5E-51 1 135

GO

GO Term Description Terminal node
GO:0005741 mitochondrial outer membrane Yes
GO:0006886 intracellular protein transport Yes
GO:0098588 bounding membrane of organelle No
GO:0019867 outer membrane No
GO:0044464 cell part No
GO:0051179 localization No
GO:0042886 amide transport No
GO:0071702 organic substance transport No
GO:0051641 cellular localization No
GO:0031090 organelle membrane No
GO:0051234 establishment of localization No
GO:0008104 protein localization No
GO:0044429 mitochondrial part No
GO:0046907 intracellular transport No
GO:0044444 cytoplasmic part No
GO:0044446 intracellular organelle part No
GO:0051649 establishment of localization in cell No
GO:0045184 establishment of protein localization No
GO:0031966 mitochondrial membrane No
GO:0016020 membrane No
GO:0071705 nitrogen compound transport No
GO:0098805 whole membrane No
GO:0015833 peptide transport No
GO:0033036 macromolecule localization No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0044422 organelle part No
GO:0015031 protein transport No
GO:0031968 organelle outer membrane No
GO:0044424 intracellular part No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 94 113 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2150.t1
MVKLTEVEDEHFTDKPTATKHDALLVSDDEDDYSDTDSEISDEEDIELEAESLYERIAALKDIVPPSARRNVSST
VSSITNLTKATFSFSGKALWIISTSAFLLGVPFALAYAEEEQYIQMEREQGMIKGANEMLIPGSEPEKTAQPTL*
Coding >Pro_DTO377G3_2|g2150.t1
ATGGTCAAGCTCACTGAAGTCGAAGACGAGCACTTCACCGATAAGCCCACTGCCACCAAACACGATGCTCTTTTG
GTCTCCGATGATGAGGATGACTACTCAGACACTGACTCCGAGATCTCCGACGAGGAAGATATCGAGCTCGAGGCT
GAGTCGCTCTACGAGCGTATCGCCGCTCTGAAAGACATTGTTCCCCCATCCGCCCGCCGCAACGTCTCCAGCACC
GTCTCTTCCATCACAAACCTCACCAAGGCCACCTTTTCGTTCAGCGGCAAGGCCCTCTGGATTATCAGCACCAGT
GCTTTCCTGCTCGGTGTGCCATTCGCTTTGGCCTACGCCGAGGAGGAGCAGTACATCCAGATGGAGCGCGAGCAG
GGAATGATCAAGGGAGCTAACGAGATGCTCATCCCCGGCTCCGAACCCGAGAAGACGGCTCAACCTACTCTGTAA
Transcript >Pro_DTO377G3_2|g2150.t1
ATGGTCAAGCTCACTGAAGTCGAAGACGAGCACTTCACCGATAAGCCCACTGCCACCAAACACGATGCTCTTTTG
GTCTCCGATGATGAGGATGACTACTCAGACACTGACTCCGAGATCTCCGACGAGGAAGATATCGAGCTCGAGGCT
GAGTCGCTCTACGAGCGTATCGCCGCTCTGAAAGACATTGTTCCCCCATCCGCCCGCCGCAACGTCTCCAGCACC
GTCTCTTCCATCACAAACCTCACCAAGGCCACCTTTTCGTTCAGCGGCAAGGCCCTCTGGATTATCAGCACCAGT
GCTTTCCTGCTCGGTGTGCCATTCGCTTTGGCCTACGCCGAGGAGGAGCAGTACATCCAGATGGAGCGCGAGCAG
GGAATGATCAAGGGAGCTAACGAGATGCTCATCCCCGGCTCCGAACCCGAGAAGACGGCTCAACCTACTCTGTAA
Gene >Pro_DTO377G3_2|g2150.t1
ATGGTCAAGCTCACTGAAGTCGAAGACGAGCACTTCACCGATAAGCCCACTGCCACCAAACACGATGCTCTTTTG
GTCTCCGATGATGAGGATGACTACTCAGACACTGGTTAGTACCGAAACCCGAACGCCCATAATCAGACGAAACTC
GCATCGCGCCATTGTCATTTGCATGGGGAATCGCTTTGATGGGAAGATATTCTGCTCCCTGAAGTTCCTCCTATC
ATCCCAGTCCCCAATCCCAATCCTCAACAATGCGACATCGAAACCCAGAAATGAACACTGGTCTGAAATCAACAT
AAAGTACCGTATCTAACATGGGCATCAATGCAAAATAGACTCCGAGATCTCCGACGAGGAAGATATCGAGCTCGA
GGCTGAGTCGCTCTACGAGCGTATCGCCGCTCTGAAAGACATTGTTCCCCCATCCGCCCGCCGCAACGTCTCCAG
CACCGTCTCTTCCATCACAAACCTCACCAAGGCCACCTTTTCGTTCAGCGGCAAGGCCCTCTGGATTATCAGCAC
CAGTGCTTTCCTGCTCGGTGTGCCATTCGCTTTGGCCTACGCCGAGGAGGAGCAGTACATCCAGATGGAGCGCGA
GCAGGGAATGATCAAGGGAGCTAACGAGGTATGTGTTTTACTTCTTTTTCACCTTTTTTGCTCCGGATTTTCCGG
CATTGCAACAGTTATCTTGAATCCCCGATTCGTGCTGTCATTGGCACTATTGACACCGTGTACATTGCCTCGGGT
ATTCGCATCTCGGCAATCTTCCATAATATTTCTCTTTCTCGACACTATCATCAAATGGCATTTTTTGCGCTCTTC
GGCGGACTCTCAGTCTTTGAAACGATATACTAATTATGATTCCTACTCGCAGATGCTCATCCCCGGCTCCGAACC
CGAGAAGACGGCTCAACCTACTCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail