Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g214.t1
Gene name
Locationscaffold_01:556282..557859
Strand-
Gene length (bp)1577
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03800 Nuf2 Nuf2 family 1.7E-43 35 175
PF18595 DHR10 Designed helical repeat protein 10 domain 3.8E-34 287 403

GO

GO Term Description Terminal node
GO:0000776 kinetochore Yes
GO:0031262 Ndc80 complex Yes
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0032991 protein-containing complex No
GO:0044427 chromosomal part No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0044424 intracellular part No
GO:0044422 organelle part No
GO:0044446 intracellular organelle part No
GO:0044464 cell part No
GO:0043226 organelle No
GO:0043228 non-membrane-bounded organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g214.t1
MSRNSTAMGYNSRMSQQFQGNQHHGRGRKKEDENDALMRLPDKEIAGCINDIGIPFTLADLAKPNAQQIQMVFEW
FAELLMNTTRETVEPAMHAAAEDLCGDYPDIIPNDTRNLMGFFMMLRKLLAECGVNDFTFTDLTKPTHERLVKIF
SYLINFVRFRESQTPVIDEHFNKTEKTKSRIDELLAENQEMELRLREMRQDLQSNEANVREKVSRNDALKARLLE
LGREQSRVAETLDRVKTERARRQQQLEEKTERTVRSRQEAEKLRPYVLESPASLQSSLAELSENLMREKASIDAM
ERRARALQTSSDTFTVVSNDVQGCVKLLDDISAEMQKEDEEESRAARTAEAISDRGNSVREVEQTEKLLQRQLAR
WVERIEALQKNAQEKAELAQARMEELRNVQKQLREERAEKQRDMERRRIRIEQTEKKMVDLKENIETEIQSAHDQ
YLKLESHIKLYMTEMEKSL*
Coding >Pro_DTO377G3_2|g214.t1
ATGTCGCGCAACTCTACCGCCATGGGATATAACAGCCGTATGAGCCAGCAATTCCAAGGCAACCAGCACCACGGT
CGGGGTCGCAAGAAGGAGGACGAAAATGACGCCCTCATGCGCTTGCCCGACAAAGAGATCGCAGGATGTATCAAC
GATATCGGTATACCGTTTACCCTCGCCGACCTGGCTAAACCAAACGCCCAACAAATCCAGATGGTGTTCGAATGG
TTCGCGGAACTGCTCATGAATACGACTCGAGAGACAGTGGAACCCGCAATGCATGCAGCTGCAGAAGATCTATGC
GGCGACTACCCTGATATAATTCCCAATGACACTCGCAACCTCATGGGTTTCTTTATGATGCTGCGAAAGCTATTG
GCGGAGTGCGGTGTCAACGACTTCACCTTCACAGACCTGACCAAACCGACGCATGAACGACTCGTCAAAATATTC
TCGTACTTGATTAACTTTGTTCGATTCCGGGAATCGCAAACACCTGTGATCGACGAGCACTTTAACAAGACAGAA
AAAACGAAATCGCGCATAGACGAACTTCTGGCGGAAAATCAGGAGATGGAATTAAGGCTGAGGGAAATGCGGCAG
GATCTCCAATCCAATGAAGCGAATGTGAGAGAGAAAGTTTCCCGAAACGATGCGCTTAAGGCGCGGCTATTGGAA
CTGGGTCGGGAGCAGTCGCGAGTCGCAGAAACACTTGATCGAGTTAAGACGGAAAGAGCTCGGCGGCAGCAGCAA
TTGGAAGAGAAAACCGAACGAACCGTCCGTTCTCGACAAGAAGCGGAGAAACTGCGGCCTTATGTGCTCGAGTCT
CCGGCCAGCCTCCAGTCCTCACTGGCTGAACTATCCGAGAATCTGATGCGCGAAAAGGCCTCCATTGATGCGATG
GAGAGGCGAGCACGCGCACTGCAGACCTCTTCGGATACGTTCACCGTGGTTTCCAATGATGTGCAGGGATGTGTT
AAATTGCTCGATGACATTTCAGCTGAGATGCAAAAAGAGGATGAAGAGGAGTCTCGTGCTGCTAGAACTGCAGAG
GCTATTTCGGACAGGGGGAACAGCGTCCGCGAGGTCGAGCAGACCGAGAAGCTCTTGCAGCGTCAACTGGCCCGT
TGGGTCGAGCGCATCGAGGCACTTCAGAAAAATGCACAGGAGAAAGCCGAACTTGCGCAGGCACGCATGGAAGAA
CTCCGAAATGTGCAAAAACAGCTCCGCGAGGAGCGTGCGGAGAAGCAGCGCGATATGGAGCGGAGGCGTATTCGC
ATTGAACAGACAGAGAAGAAGATGGTTGACTTGAAGGAGAACATTGAGACCGAGATTCAGTCAGCCCACGATCAG
TACCTAAAGTTAGAGTCACATATCAAGCTGTACATGACAGAGATGGAGAAGTCTCTATGA
Transcript >Pro_DTO377G3_2|g214.t1
ATGTCGCGCAACTCTACCGCCATGGGATATAACAGCCGTATGAGCCAGCAATTCCAAGGCAACCAGCACCACGGT
CGGGGTCGCAAGAAGGAGGACGAAAATGACGCCCTCATGCGCTTGCCCGACAAAGAGATCGCAGGATGTATCAAC
GATATCGGTATACCGTTTACCCTCGCCGACCTGGCTAAACCAAACGCCCAACAAATCCAGATGGTGTTCGAATGG
TTCGCGGAACTGCTCATGAATACGACTCGAGAGACAGTGGAACCCGCAATGCATGCAGCTGCAGAAGATCTATGC
GGCGACTACCCTGATATAATTCCCAATGACACTCGCAACCTCATGGGTTTCTTTATGATGCTGCGAAAGCTATTG
GCGGAGTGCGGTGTCAACGACTTCACCTTCACAGACCTGACCAAACCGACGCATGAACGACTCGTCAAAATATTC
TCGTACTTGATTAACTTTGTTCGATTCCGGGAATCGCAAACACCTGTGATCGACGAGCACTTTAACAAGACAGAA
AAAACGAAATCGCGCATAGACGAACTTCTGGCGGAAAATCAGGAGATGGAATTAAGGCTGAGGGAAATGCGGCAG
GATCTCCAATCCAATGAAGCGAATGTGAGAGAGAAAGTTTCCCGAAACGATGCGCTTAAGGCGCGGCTATTGGAA
CTGGGTCGGGAGCAGTCGCGAGTCGCAGAAACACTTGATCGAGTTAAGACGGAAAGAGCTCGGCGGCAGCAGCAA
TTGGAAGAGAAAACCGAACGAACCGTCCGTTCTCGACAAGAAGCGGAGAAACTGCGGCCTTATGTGCTCGAGTCT
CCGGCCAGCCTCCAGTCCTCACTGGCTGAACTATCCGAGAATCTGATGCGCGAAAAGGCCTCCATTGATGCGATG
GAGAGGCGAGCACGCGCACTGCAGACCTCTTCGGATACGTTCACCGTGGTTTCCAATGATGTGCAGGGATGTGTT
AAATTGCTCGATGACATTTCAGCTGAGATGCAAAAAGAGGATGAAGAGGAGTCTCGTGCTGCTAGAACTGCAGAG
GCTATTTCGGACAGGGGGAACAGCGTCCGCGAGGTCGAGCAGACCGAGAAGCTCTTGCAGCGTCAACTGGCCCGT
TGGGTCGAGCGCATCGAGGCACTTCAGAAAAATGCACAGGAGAAAGCCGAACTTGCGCAGGCACGCATGGAAGAA
CTCCGAAATGTGCAAAAACAGCTCCGCGAGGAGCGTGCGGAGAAGCAGCGCGATATGGAGCGGAGGCGTATTCGC
ATTGAACAGACAGAGAAGAAGATGGTTGACTTGAAGGAGAACATTGAGACCGAGATTCAGTCAGCCCACGATCAG
TACCTAAAGTTAGAGTCACATATCAAGCTGTACATGACAGAGATGGAGAAGTCTCTATGA
Gene >Pro_DTO377G3_2|g214.t1
ATGTCGCGCAACTCTACCGCCATGGGATATAACAGCCGTATGAGCCAGCAATTCCAAGGCAACCAGCACCACGGT
CGGGGTCGCAAGAAGGAGGACGAAAATGACGCCCTCATGCGCTTGGTGAGCTTGATTTTTGCCGGAGCTTTCGTC
TGATACTAACATGAAATAGCCCGACAAAGAGATCGCAGGATGTATCAACGATATCGGTATACCGTTTACCCTCGC
CGACCTGGCTAAACCAAACGCCCAACAAATCCAGATGGTGTTCGAATGGTTCGCGGAACTGCTCATGAATACGAC
TCGAGAGACAGTGGAACCCGCAATGCATGCAGCTGCAGAAGATCTATGCGGCGACTACCCTGATATAATTCCCAA
TGACACTCGCAACCTCATGGGTTTCTTTATGATGCTGCGAAAGCTATTGGCGGAGGTATCTGCTCATCACTAGCT
ACAAAAGCCCCGAAGAGTATGCTAATGCCTATAGTACAAAACAGTGCGGTGTCAACGACTTCACCTTCACAGACC
TGACCAAACCGACGCATGAACGACTCGTCAAAATATTCTCGTACTTGATTAACTTTGTTCGATTCCGGGAATCGC
AAACACCTGTGATCGACGAGCACTTTAACAAGACAGAAAAAACGAAATCGCGCATAGACGAACTTCTGGCGGAAA
ATCAGGAGATGGAATTAAGGCTGAGGGAAATGCGGCAGGATCTCCAATCCAATGAAGCGAATGTGAGAGAGAAAG
TTTCCCGAAACGATGCGCTTAAGGCGCGGCTATTGGAACTGGGTCGGGAGCAGTCGCGAGTCGCAGAAACACTTG
ATCGAGTTAAGACGGAAAGAGCTCGGCGGCAGCAGCAATTGGAAGAGAAAACCGAACGAACCGTCCGTTCTCGAC
AAGAAGCGGAGAAACTGCGGCCTTATGTGCTCGAGTCTCCGGCCAGCCTCCAGTCCTCACTGGCTGAACTATCCG
AGAATCTGATGCGCGAAAAGGCCTCCATTGATGCGATGGAGAGGCGAGCACGCGCACTGCAGACCTCTTCGGATA
CGTTCACCGTGGTTTCCAATGATGTGCAGGGATGTGTTAAATTGCTCGATGACATTTCAGCTGAGATGCAAAAAG
AGGATGAAGAGGAGTCTCGTGCTGCTAGAACTGCAGAGGCTATTTCGGACAGGGGGAACAGCGTCCGCGAGGTCG
AGCAGACCGAGAAGCTCTTGCAGCGTCAACTGGCCCGTTGGGTCGAGCGCATCGAGGCACTTCAGAAAAATGCAC
AGGAGAAAGCCGAACTTGCGCAGGCACGCATGGAAGAACTCCGAAATGTGCAAAAACAGCTCCGCGAGGAGCGTG
CGGAGAAGCAGCGCGATATGGAGCGGAGGCGTATTCGCATTGAACAGACAGAGAAGAAGGTACGTCTTACCCTGT
GTCGTGGGTGATGAACTATTGCTAACCCACTCTTCTAGATGGTTGACTTGAAGGAGAACATTGAGACCGAGATTC
AGTCAGCCCACGATCAGTACCTAAAGTTAGAGTCACATATCAAGCTGTACATGACAGAGATGGAGAAGTCTCTAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail