Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2100.t1
Gene name
Locationscaffold_02:1660400..1663317
Strand-
Gene length (bp)2917
Transcript length (bp)2862
Coding sequence length (bp)2862
Protein length (aa) 954

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 1.8E-66 590 953
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 1.8E-57 174 586

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0005515 protein binding No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No
GO:0015631 tubulin binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 6.03 2.69 9.37
5d_25C Five days - 25 degrees Celsius 5.04 2.13 7.96
7d_25C Seven days - 25 degrees Celsius 4.29 1.68 6.90
10d_25C Ten days - 25 degrees Celsius 3.42 1.28 5.57
7d_15C Seven days - 15 degrees Celsius 4.29 1.69 6.90
7d_30C Seven days - 30 degrees Celsius 4.81 2.01 7.61

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.658252 no
3d_25C 7d_25C 0.348389 no
3d_25C 7d_15C 0.348311 no
3d_25C 7d_30C 0.558907 no
3d_25C 10d_25C 0.076395 no
5d_25C 7d_25C 0.714714 no
5d_25C 7d_15C 0.714136 no
5d_25C 7d_30C 0.925395 no
5d_25C 10d_25C 0.272394 no
7d_25C 7d_15C 0.997942 no
7d_25C 7d_30C 0.810424 no
7d_25C 10d_25C 0.584389 no
7d_15C 7d_30C 0.810929 no
7d_15C 10d_25C 0.581775 no
7d_30C 10d_25C 0.353469 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2100.t1
MDYDHELDPFSSESLWRLSKFSIEALQPLGSLPWNTTLSGDTTSCFEIYPQPEDKIDPVWKLDLFPTGLEKPESV
TDSSINPSIDSESDTTCDSLRDISGDNNDIWSLDLLQEEPGQIPPQKSWERYQHKSFQEPVSAYFSESGAQGFDA
ALVQRNMVKKDGAPTRIVRTDVFIRSLLRLGLGWSSAFFRYDQRTNQFERCLKDNIRVSGISLMALENVIENVVQ
CGTNMQRLRLFAQDPPANYRELSTFFTLTSTVEIIIFNLEQQISDHSKNIASLLQIKALFHRCGDVVGVLAAIVG
AAQRAVSDAQVISIVVERAAFFAQKFGWIENLVHEIVIRVTQPWFGFIETWIGLRSEDAALKEYMTNDKSFVRLE
TYDRGKFKTGPARIDYIYQAEHMPSFIPADQARSIFECGRSLQLLKRSHPRHPIARRDVLSRIGGLHLHCATTWA
GIEQIQTKAQEYESRLRAEIKKYHQGDAGLQDSSSNVVTQTVDQTANTEVTTTAFQLFDIDDEKNDSGPVTDYKA
LSKDGLKRLLDKARGFEAEDTNERSYLGPELTYGLHLSLAPILSSQALLIDYSCLHLLFKEHRIRHHLNMQWRFQ
LLGEGSFVARLSNSLFDPEMESGERRAGKVRSGVDTGLRLGSRDTWPPASSELRLVLIGLLGDCYFGGTNTEDDE
KTHAQKDKELPGGLSFGIRELTDEEIEGCKNPNAIEALDFLRLQYTPPEVLESLITARSLNKYDCLFKHLLRLIR
MASAVKRLIRDSTARGSLSGDTHNVYQKFRMDAQHFVLAVSDYCFHIGIGSIWQRFQDTLTKIEHCLNRGDIDGT
IEAAHSVPRLRDYHEDILDQMLFALFLSKRHAQAAKLLESIFGTILSFGLLSRADGIGMRNESEGAVLHLYQSFR
KQTSAFVNYLRSMESGKATSKSMAKSGEFFSSRTDPTSVFEHLRVRLDVKNYY*
Coding >Pro_DTO377G3_2|g2100.t1
ATGGACTATGATCATGAGCTGGATCCTTTCTCGAGTGAAAGCCTCTGGAGACTCTCCAAATTCAGCATAGAAGCT
CTGCAGCCATTGGGATCGTTACCATGGAACACTACTCTAAGTGGTGATACTACATCTTGTTTTGAGATATACCCA
CAGCCTGAAGACAAGATCGACCCTGTATGGAAGCTGGATCTCTTTCCAACCGGCTTGGAGAAACCAGAATCAGTT
ACCGACTCGAGCATCAATCCCTCCATAGACAGCGAGTCTGACACAACATGTGATTCTTTAAGAGACATATCAGGC
GACAACAACGATATCTGGTCTTTGGATTTACTTCAGGAAGAACCTGGTCAAATACCCCCGCAGAAATCGTGGGAG
AGGTATCAACATAAGTCTTTCCAAGAGCCTGTGTCAGCCTATTTTAGCGAATCTGGAGCACAGGGCTTCGATGCA
GCCTTGGTACAACGAAACATGGTAAAGAAAGACGGTGCGCCTACTCGAATTGTTCGAACAGATGTGTTCATTCGA
TCACTACTTCGTCTTGGGCTTGGCTGGAGCTCTGCATTCTTTCGCTACGATCAACGAACCAACCAATTTGAAAGA
TGTTTGAAGGATAATATCCGAGTCTCTGGTATTAGCCTGATGGCCTTGGAAAATGTGATCGAAAATGTGGTACAA
TGCGGTACCAACATGCAGCGCCTGCGGTTATTTGCCCAAGACCCGCCAGCCAACTACAGAGAACTTTCTACGTTT
TTCACATTAACTAGCACGGTTGAGATAATAATCTTTAACCTGGAACAACAGATCTCCGATCATTCAAAAAATATT
GCTTCACTTCTACAAATAAAGGCACTATTTCACCGCTGCGGGGACGTGGTAGGCGTCCTGGCAGCTATTGTTGGC
GCTGCACAAAGGGCTGTCTCGGACGCACAAGTCATATCAATTGTCGTGGAACGTGCAGCTTTTTTTGCCCAGAAG
TTTGGCTGGATCGAGAACCTTGTGCATGAGATTGTGATTCGAGTGACTCAGCCATGGTTCGGATTCATCGAGACT
TGGATTGGGCTTAGATCCGAAGACGCAGCTCTCAAAGAATATATGACAAACGACAAAAGCTTCGTCCGACTGGAA
ACTTATGACCGTGGCAAGTTCAAGACTGGGCCAGCGCGAATTGACTATATCTACCAAGCGGAGCACATGCCGTCT
TTCATCCCGGCCGACCAAGCCCGTTCTATCTTTGAGTGTGGGCGAAGTCTTCAACTATTGAAACGATCCCATCCT
CGTCATCCTATCGCACGGCGCGATGTTCTCTCACGAATCGGTGGTCTCCATCTGCATTGTGCGACCACCTGGGCT
GGCATTGAGCAAATTCAAACAAAAGCCCAGGAATACGAGTCAAGACTCCGCGCTGAGATCAAGAAATATCATCAG
GGGGATGCAGGCTTGCAGGATTCATCATCAAATGTGGTCACCCAGACCGTCGATCAAACTGCCAACACAGAGGTT
ACAACGACAGCCTTTCAACTCTTCGATATCGACGATGAAAAAAATGATTCAGGACCAGTGACGGATTACAAGGCT
CTTTCGAAAGATGGCCTCAAGCGACTGCTCGATAAAGCCCGGGGATTTGAAGCCGAAGATACCAATGAAAGAAGC
TATCTTGGTCCTGAGTTGACATATGGCCTCCATTTATCCCTTGCTCCCATTCTTTCGTCACAGGCACTTCTCATC
GACTACTCTTGCCTGCACCTTCTCTTCAAAGAGCATCGAATTCGCCATCATCTGAACATGCAATGGCGTTTCCAG
TTGCTGGGAGAGGGCTCGTTTGTCGCTCGTCTTTCTAATTCACTGTTCGACCCGGAAATGGAAAGTGGAGAGCGA
AGGGCTGGAAAAGTGCGCAGTGGTGTCGACACCGGTCTACGCCTCGGCAGTCGTGACACATGGCCGCCAGCTAGT
TCAGAGTTGCGACTCGTCTTAATTGGTCTGCTCGGAGATTGTTACTTTGGTGGCACAAATACAGAAGATGACGAA
AAAACGCACGCCCAGAAGGACAAGGAATTGCCTGGTGGCCTGAGCTTCGGAATTCGAGAATTGACAGACGAAGAA
ATTGAAGGATGTAAAAATCCGAATGCAATAGAGGCTTTGGACTTCCTTCGTCTGCAGTACACACCACCAGAAGTT
CTTGAATCTCTCATTACTGCTCGCTCTTTGAATAAGTATGATTGTCTGTTCAAGCATTTGCTCCGGTTAATCCGC
ATGGCTTCTGCCGTTAAACGACTTATCCGGGATTCTACTGCCCGAGGATCTCTATCAGGAGACACACACAATGTG
TACCAGAAGTTCAGAATGGATGCCCAGCACTTTGTGCTAGCGGTAAGTGATTACTGCTTCCATATTGGAATTGGG
TCCATCTGGCAGCGCTTTCAAGACACACTTACCAAAATCGAGCACTGCCTCAACCGCGGTGACATCGACGGTACG
ATTGAAGCGGCTCACTCGGTACCACGACTTCGCGACTATCACGAAGATATCCTTGACCAGATGTTGTTCGCATTA
TTCCTCAGTAAGCGCCATGCGCAGGCTGCCAAACTGCTCGAGTCAATTTTCGGCACTATTCTCAGTTTCGGCCTT
CTCTCAAGGGCAGATGGAATTGGGATGCGCAACGAAAGCGAAGGGGCTGTTCTCCACCTGTATCAGTCTTTCAGA
AAACAGACCTCCGCCTTTGTCAATTACCTTCGCAGCATGGAGTCCGGAAAAGCCACTTCGAAATCAATGGCTAAA
TCAGGGGAATTCTTCTCTTCGCGGACAGACCCAACCAGCGTTTTTGAGCATCTACGAGTGAGATTAGACGTCAAG
AACTATTATTGA
Transcript >Pro_DTO377G3_2|g2100.t1
ATGGACTATGATCATGAGCTGGATCCTTTCTCGAGTGAAAGCCTCTGGAGACTCTCCAAATTCAGCATAGAAGCT
CTGCAGCCATTGGGATCGTTACCATGGAACACTACTCTAAGTGGTGATACTACATCTTGTTTTGAGATATACCCA
CAGCCTGAAGACAAGATCGACCCTGTATGGAAGCTGGATCTCTTTCCAACCGGCTTGGAGAAACCAGAATCAGTT
ACCGACTCGAGCATCAATCCCTCCATAGACAGCGAGTCTGACACAACATGTGATTCTTTAAGAGACATATCAGGC
GACAACAACGATATCTGGTCTTTGGATTTACTTCAGGAAGAACCTGGTCAAATACCCCCGCAGAAATCGTGGGAG
AGGTATCAACATAAGTCTTTCCAAGAGCCTGTGTCAGCCTATTTTAGCGAATCTGGAGCACAGGGCTTCGATGCA
GCCTTGGTACAACGAAACATGGTAAAGAAAGACGGTGCGCCTACTCGAATTGTTCGAACAGATGTGTTCATTCGA
TCACTACTTCGTCTTGGGCTTGGCTGGAGCTCTGCATTCTTTCGCTACGATCAACGAACCAACCAATTTGAAAGA
TGTTTGAAGGATAATATCCGAGTCTCTGGTATTAGCCTGATGGCCTTGGAAAATGTGATCGAAAATGTGGTACAA
TGCGGTACCAACATGCAGCGCCTGCGGTTATTTGCCCAAGACCCGCCAGCCAACTACAGAGAACTTTCTACGTTT
TTCACATTAACTAGCACGGTTGAGATAATAATCTTTAACCTGGAACAACAGATCTCCGATCATTCAAAAAATATT
GCTTCACTTCTACAAATAAAGGCACTATTTCACCGCTGCGGGGACGTGGTAGGCGTCCTGGCAGCTATTGTTGGC
GCTGCACAAAGGGCTGTCTCGGACGCACAAGTCATATCAATTGTCGTGGAACGTGCAGCTTTTTTTGCCCAGAAG
TTTGGCTGGATCGAGAACCTTGTGCATGAGATTGTGATTCGAGTGACTCAGCCATGGTTCGGATTCATCGAGACT
TGGATTGGGCTTAGATCCGAAGACGCAGCTCTCAAAGAATATATGACAAACGACAAAAGCTTCGTCCGACTGGAA
ACTTATGACCGTGGCAAGTTCAAGACTGGGCCAGCGCGAATTGACTATATCTACCAAGCGGAGCACATGCCGTCT
TTCATCCCGGCCGACCAAGCCCGTTCTATCTTTGAGTGTGGGCGAAGTCTTCAACTATTGAAACGATCCCATCCT
CGTCATCCTATCGCACGGCGCGATGTTCTCTCACGAATCGGTGGTCTCCATCTGCATTGTGCGACCACCTGGGCT
GGCATTGAGCAAATTCAAACAAAAGCCCAGGAATACGAGTCAAGACTCCGCGCTGAGATCAAGAAATATCATCAG
GGGGATGCAGGCTTGCAGGATTCATCATCAAATGTGGTCACCCAGACCGTCGATCAAACTGCCAACACAGAGGTT
ACAACGACAGCCTTTCAACTCTTCGATATCGACGATGAAAAAAATGATTCAGGACCAGTGACGGATTACAAGGCT
CTTTCGAAAGATGGCCTCAAGCGACTGCTCGATAAAGCCCGGGGATTTGAAGCCGAAGATACCAATGAAAGAAGC
TATCTTGGTCCTGAGTTGACATATGGCCTCCATTTATCCCTTGCTCCCATTCTTTCGTCACAGGCACTTCTCATC
GACTACTCTTGCCTGCACCTTCTCTTCAAAGAGCATCGAATTCGCCATCATCTGAACATGCAATGGCGTTTCCAG
TTGCTGGGAGAGGGCTCGTTTGTCGCTCGTCTTTCTAATTCACTGTTCGACCCGGAAATGGAAAGTGGAGAGCGA
AGGGCTGGAAAAGTGCGCAGTGGTGTCGACACCGGTCTACGCCTCGGCAGTCGTGACACATGGCCGCCAGCTAGT
TCAGAGTTGCGACTCGTCTTAATTGGTCTGCTCGGAGATTGTTACTTTGGTGGCACAAATACAGAAGATGACGAA
AAAACGCACGCCCAGAAGGACAAGGAATTGCCTGGTGGCCTGAGCTTCGGAATTCGAGAATTGACAGACGAAGAA
ATTGAAGGATGTAAAAATCCGAATGCAATAGAGGCTTTGGACTTCCTTCGTCTGCAGTACACACCACCAGAAGTT
CTTGAATCTCTCATTACTGCTCGCTCTTTGAATAAGTATGATTGTCTGTTCAAGCATTTGCTCCGGTTAATCCGC
ATGGCTTCTGCCGTTAAACGACTTATCCGGGATTCTACTGCCCGAGGATCTCTATCAGGAGACACACACAATGTG
TACCAGAAGTTCAGAATGGATGCCCAGCACTTTGTGCTAGCGGTAAGTGATTACTGCTTCCATATTGGAATTGGG
TCCATCTGGCAGCGCTTTCAAGACACACTTACCAAAATCGAGCACTGCCTCAACCGCGGTGACATCGACGGTACG
ATTGAAGCGGCTCACTCGGTACCACGACTTCGCGACTATCACGAAGATATCCTTGACCAGATGTTGTTCGCATTA
TTCCTCAGTAAGCGCCATGCGCAGGCTGCCAAACTGCTCGAGTCAATTTTCGGCACTATTCTCAGTTTCGGCCTT
CTCTCAAGGGCAGATGGAATTGGGATGCGCAACGAAAGCGAAGGGGCTGTTCTCCACCTGTATCAGTCTTTCAGA
AAACAGACCTCCGCCTTTGTCAATTACCTTCGCAGCATGGAGTCCGGAAAAGCCACTTCGAAATCAATGGCTAAA
TCAGGGGAATTCTTCTCTTCGCGGACAGACCCAACCAGCGTTTTTGAGCATCTACGAGTGAGATTAGACGTCAAG
AACTATTATTGA
Gene >Pro_DTO377G3_2|g2100.t1
ATGGACTATGATCATGAGCTGGATCCTTTCTCGAGTGAAAGCCTCTGGAGACTCTCCAAATTCAGCATAGAAGCT
CTGCAGCCATTGGGATCGTTACCATGGAACACTACTCTAAGTGGTAAGTCTCAACCGCAGATACTTTAGGGCCTT
CAATAACACTCATTTATTTATAGGTGATACTACATCTTGTTTTGAGATATACCCACAGCCTGAAGACAAGATCGA
CCCTGTATGGAAGCTGGATCTCTTTCCAACCGGCTTGGAGAAACCAGAATCAGTTACCGACTCGAGCATCAATCC
CTCCATAGACAGCGAGTCTGACACAACATGTGATTCTTTAAGAGACATATCAGGCGACAACAACGATATCTGGTC
TTTGGATTTACTTCAGGAAGAACCTGGTCAAATACCCCCGCAGAAATCGTGGGAGAGGTATCAACATAAGTCTTT
CCAAGAGCCTGTGTCAGCCTATTTTAGCGAATCTGGAGCACAGGGCTTCGATGCAGCCTTGGTACAACGAAACAT
GGTAAAGAAAGACGGTGCGCCTACTCGAATTGTTCGAACAGATGTGTTCATTCGATCACTACTTCGTCTTGGGCT
TGGCTGGAGCTCTGCATTCTTTCGCTACGATCAACGAACCAACCAATTTGAAAGATGTTTGAAGGATAATATCCG
AGTCTCTGGTATTAGCCTGATGGCCTTGGAAAATGTGATCGAAAATGTGGTACAATGCGGTACCAACATGCAGCG
CCTGCGGTTATTTGCCCAAGACCCGCCAGCCAACTACAGAGAACTTTCTACGTTTTTCACATTAACTAGCACGGT
TGAGATAATAATCTTTAACCTGGAACAACAGATCTCCGATCATTCAAAAAATATTGCTTCACTTCTACAAATAAA
GGCACTATTTCACCGCTGCGGGGACGTGGTAGGCGTCCTGGCAGCTATTGTTGGCGCTGCACAAAGGGCTGTCTC
GGACGCACAAGTCATATCAATTGTCGTGGAACGTGCAGCTTTTTTTGCCCAGAAGTTTGGCTGGATCGAGAACCT
TGTGCATGAGATTGTGATTCGAGTGACTCAGCCATGGTTCGGATTCATCGAGACTTGGATTGGGCTTAGATCCGA
AGACGCAGCTCTCAAAGAATATATGACAAACGACAAAAGCTTCGTCCGACTGGAAACTTATGACCGTGGCAAGTT
CAAGACTGGGCCAGCGCGAATTGACTATATCTACCAAGCGGAGCACATGCCGTCTTTCATCCCGGCCGACCAAGC
CCGTTCTATCTTTGAGTGTGGGCGAAGTCTTCAACTATTGAAACGATCCCATCCTCGTCATCCTATCGCACGGCG
CGATGTTCTCTCACGAATCGGTGGTCTCCATCTGCATTGTGCGACCACCTGGGCTGGCATTGAGCAAATTCAAAC
AAAAGCCCAGGAATACGAGTCAAGACTCCGCGCTGAGATCAAGAAATATCATCAGGGGGATGCAGGCTTGCAGGA
TTCATCATCAAATGTGGTCACCCAGACCGTCGATCAAACTGCCAACACAGAGGTTACAACGACAGCCTTTCAACT
CTTCGATATCGACGATGAAAAAAATGATTCAGGACCAGTGACGGATTACAAGGCTCTTTCGAAAGATGGCCTCAA
GCGACTGCTCGATAAAGCCCGGGGATTTGAAGCCGAAGATACCAATGAAAGAAGCTATCTTGGTCCTGAGTTGAC
ATATGGCCTCCATTTATCCCTTGCTCCCATTCTTTCGTCACAGGCACTTCTCATCGACTACTCTTGCCTGCACCT
TCTCTTCAAAGAGCATCGAATTCGCCATCATCTGAACATGCAATGGCGTTTCCAGTTGCTGGGAGAGGGCTCGTT
TGTCGCTCGTCTTTCTAATTCACTGTTCGACCCGGAAATGGAAAGTGGAGAGCGAAGGGCTGGAAAAGTGCGCAG
TGGTGTCGACACCGGTCTACGCCTCGGCAGTCGTGACACATGGCCGCCAGCTAGTTCAGAGTTGCGACTCGTCTT
AATTGGTCTGCTCGGAGATTGTTACTTTGGTGGCACAAATACAGAAGATGACGAAAAAACGCACGCCCAGAAGGA
CAAGGAATTGCCTGGTGGCCTGAGCTTCGGAATTCGAGAATTGACAGACGAAGAAATTGAAGGATGTAAAAATCC
GAATGCAATAGAGGCTTTGGACTTCCTTCGTCTGCAGTACACACCACCAGAAGTTCTTGAATCTCTCATTACTGC
TCGCTCTTTGAATAAGTATGATTGTCTGTTCAAGCATTTGCTCCGGTTAATCCGCATGGCTTCTGCCGTTAAACG
ACTTATCCGGGATTCTACTGCCCGAGGATCTCTATCAGGAGACACACACAATGTGTACCAGAAGTTCAGAATGGA
TGCCCAGCACTTTGTGCTAGCGGTAAGTGATTACTGCTTCCATATTGGAATTGGGTCCATCTGGCAGCGCTTTCA
AGACACACTTACCAAAATCGAGCACTGCCTCAACCGCGGTGACATCGACGGTACGATTGAAGCGGCTCACTCGGT
ACCACGACTTCGCGACTATCACGAAGATATCCTTGACCAGATGTTGTTCGCATTATTCCTCAGTAAGCGCCATGC
GCAGGCTGCCAAACTGCTCGAGTCAATTTTCGGCACTATTCTCAGTTTCGGCCTTCTCTCAAGGGCAGATGGAAT
TGGGATGCGCAACGAAAGCGAAGGGGCTGTTCTCCACCTGTATCAGTCTTTCAGAAAACAGACCTCCGCCTTTGT
CAATTACCTTCGCAGCATGGAGTCCGGAAAAGCCACTTCGAAATCAATGGCTAAATCAGGGGAATTCTTCTCTTC
GCGGACAGACCCAACCAGCGTTTTTGAGCATCTACGAGTGAGATTAGACGTCAAGAACTATTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail