Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2099.t1
Gene name
Locationscaffold_02:1657200..1660124
Strand+
Gene length (bp)2924
Transcript length (bp)2583
Coding sequence length (bp)2583
Protein length (aa) 861

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03404 Mo-co_dimer Mo-co oxidoreductase dimerisation domain 6.5E-58 301 446
PF00174 Oxidored_molyb Oxidoreductase molybdopterin binding domain 2.0E-51 97 273
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 6.5E-34 613 718
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 3.5E-30 738 844
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 4.1E-16 512 581

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0042128 nitrate assimilation Yes
GO:0030151 molybdenum ion binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0008152 metabolic process No
GO:2001057 reactive nitrogen species metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0042126 nitrate metabolic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0046914 transition metal ion binding No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0044237 cellular metabolic process No
GO:0071941 nitrogen cycle metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2099.t1
MASITTQTITESQTISQITIENIIPSPGELDIPLPPPSKNLVDILDVDKGTPDSHVPRDPRLIRLTGVHPFNVEP
PLTALYKEGFLTPPELFYVRNHGPVPQVRDEDIPDWEISIEGLVEKPLVLSFCEVLQKYDQITAPITLVCAGNRR
KEQNTVRKSKGFSWGAAGLSTALFTGPMMADILRSAKPLRGAKYVCMEGADKLPNGFYGTSVKLNWAMDPNRGIM
LAHKMNGEDLRPDHGRPLRAVVPGQIGGRSVKWLKKLILTDTPSDNWYHINDNRVLPTMVTPEMSSQDRKWWTDE
RYAIYELNVNSVAVYPQHEEEIDISTAGPTYTVKGYAYAGGGRRIIKVEISLDRGKSWRLTEIEYAEDKYRDFDG
DLFGGKVDMWWREASFCWSFWSLEVPVADLETSDAILVRAVDEALSAMPRDMYWSVLGMMNNPWFRVAITKQGST
LKFEHPTHPAKAGGWMERVKKTGGDLLNGNWGERVEGEELVEPEPMQEINMKKDGVNRQIDLQELKANSSSEKPW
FVVNGEVYDGTGFLEGHPGGAISITSSAGLDVSEDFLAIHSETAKAMMPDYHIGTLDKASLEAMKSDSAADSDEP
RAVFLQSRAWTKATLTEKRDVSWDTRVFVFDLEHEKQTLGLPIGQHLMIKVQDPSNNEAVIRSYTPMSDTNLIGK
MELLVKVYFPTESIPGGKMTMALDKLPLSSEIECKGPTGRFEYLGNGRVSISGKERQLRSFKMICGGTGITPVFQ
VLRAVMQDTQDPTTCVVLDGNRQEEDILCRSDLDAYVETDCRKCTVVHTLTQGSDRWTGRRGRISEELLAEYAAP
EEQSMVLVCGPGPMEKSARGILLAQGWAESDLHFF*
Coding >Pro_DTO377G3_2|g2099.t1
ATGGCCAGCATAACCACACAGACGATAACAGAGTCCCAAACGATCTCTCAAATAACAATCGAGAACATCATACCA
AGTCCAGGGGAGCTAGACATCCCACTTCCACCACCGTCGAAGAACCTTGTCGACATCTTGGATGTGGATAAAGGC
ACACCGGATAGCCATGTACCTCGCGATCCACGATTGATTCGGTTAACGGGAGTTCATCCATTCAATGTGGAGCCA
CCATTGACGGCTTTATACAAAGAAGGCTTTCTCACACCCCCGGAACTGTTCTATGTTCGGAACCACGGGCCAGTG
CCCCAGGTCCGCGATGAGGATATCCCAGATTGGGAGATTAGTATAGAAGGGTTGGTTGAGAAGCCATTAGTCCTG
AGCTTCTGCGAAGTGCTTCAGAAGTACGACCAGATTACCGCCCCGATCACACTCGTATGTGCAGGCAACAGACGC
AAAGAACAGAACACAGTCCGGAAGTCGAAGGGCTTCTCATGGGGTGCGGCTGGTTTATCGACAGCGCTATTCACA
GGGCCTATGATGGCGGATATTCTACGCAGTGCGAAGCCACTTCGAGGAGCGAAGTATGTCTGTATGGAGGGCGCT
GATAAGCTGCCGAATGGATTTTACGGAACTTCGGTCAAATTGAACTGGGCCATGGACCCAAACCGAGGAATTATG
CTGGCTCATAAAATGAATGGCGAAGACCTTCGGCCGGATCATGGCCGCCCCTTGAGGGCAGTGGTGCCTGGCCAA
ATCGGAGGTCGGAGCGTGAAATGGCTGAAGAAGTTGATTCTGACTGATACCCCAAGCGATAACTGGTATCATATC
AATGATAACCGAGTACTCCCGACAATGGTGACGCCGGAAATGTCCTCCCAGGATCGCAAGTGGTGGACCGATGAG
CGATATGCTATTTATGAACTCAACGTCAATTCGGTGGCTGTGTATCCACAACACGAGGAAGAAATCGATATATCC
ACAGCTGGGCCCACGTATACAGTCAAAGGATATGCATACGCCGGGGGTGGCCGGAGGATAATAAAAGTGGAGATT
TCTCTAGACAGGGGCAAATCATGGCGCCTCACCGAGATCGAGTATGCAGAAGACAAATACCGTGATTTTGACGGC
GACCTGTTCGGTGGCAAGGTAGACATGTGGTGGAGGGAAGCATCTTTCTGCTGGTCTTTCTGGTCGTTGGAAGTC
CCAGTGGCAGACCTAGAGACTAGCGATGCAATCCTAGTCCGTGCAGTGGATGAGGCATTAAGCGCTATGCCGCGT
GACATGTACTGGTCTGTCTTGGGCATGATGAATAACCCCTGGTTCAGAGTGGCAATCACGAAACAAGGAAGTACG
CTGAAATTTGAACATCCCACACATCCAGCCAAAGCTGGCGGATGGATGGAAAGAGTCAAGAAGACTGGTGGTGAC
CTGCTTAATGGTAACTGGGGCGAAAGGGTTGAAGGCGAGGAGCTCGTCGAACCGGAGCCTATGCAAGAAATAAAT
ATGAAGAAAGACGGCGTGAACAGACAAATCGACCTGCAAGAGTTGAAAGCTAATAGCAGCAGCGAAAAGCCATGG
TTTGTTGTAAATGGCGAAGTGTATGATGGCACAGGCTTCCTCGAAGGCCACCCCGGAGGAGCGATCAGTATTACA
TCTTCTGCTGGTTTGGATGTATCAGAAGACTTCCTTGCAATCCACAGTGAAACTGCTAAGGCAATGATGCCGGAT
TACCATATTGGCACATTAGACAAAGCATCTCTTGAAGCGATGAAGAGCGATTCGGCTGCGGATTCCGATGAGCCA
CGCGCAGTGTTCCTTCAGTCTCGAGCATGGACAAAAGCCACTCTCACAGAGAAGAGAGATGTATCCTGGGATACA
CGGGTATTCGTGTTCGACCTGGAACATGAGAAGCAGACGCTCGGCCTACCAATCGGCCAGCATCTGATGATTAAA
GTCCAGGATCCATCCAATAACGAAGCAGTCATAAGATCCTATACGCCAATGTCAGACACAAACCTGATAGGCAAG
ATGGAGTTACTTGTGAAGGTCTACTTCCCAACGGAAAGCATTCCAGGAGGAAAAATGACCATGGCTCTCGACAAG
CTTCCCCTGAGCTCTGAGATCGAGTGCAAGGGTCCAACGGGCCGGTTTGAATACCTCGGCAACGGCCGGGTTTCG
ATCAGTGGTAAAGAACGCCAGCTCCGCTCGTTTAAGATGATCTGTGGAGGAACGGGAATCACACCAGTCTTTCAG
GTTCTGCGGGCTGTTATGCAAGACACGCAAGATCCCACGACATGTGTTGTGCTAGACGGCAACAGGCAGGAAGAA
GATATATTGTGTCGTTCGGACCTTGATGCTTACGTGGAGACTGACTGTCGGAAATGCACTGTCGTGCATACATTG
ACTCAAGGGTCGGATAGGTGGACTGGTCGTCGGGGCCGTATTTCTGAGGAACTGCTCGCAGAGTATGCGGCTCCA
GAAGAGCAGAGTATGGTTCTGGTCTGTGGGCCAGGGCCTATGGAGAAGTCTGCTCGCGGAATTCTTCTTGCCCAA
GGTTGGGCCGAGTCGGATCTTCACTTCTTCTAG
Transcript >Pro_DTO377G3_2|g2099.t1
ATGGCCAGCATAACCACACAGACGATAACAGAGTCCCAAACGATCTCTCAAATAACAATCGAGAACATCATACCA
AGTCCAGGGGAGCTAGACATCCCACTTCCACCACCGTCGAAGAACCTTGTCGACATCTTGGATGTGGATAAAGGC
ACACCGGATAGCCATGTACCTCGCGATCCACGATTGATTCGGTTAACGGGAGTTCATCCATTCAATGTGGAGCCA
CCATTGACGGCTTTATACAAAGAAGGCTTTCTCACACCCCCGGAACTGTTCTATGTTCGGAACCACGGGCCAGTG
CCCCAGGTCCGCGATGAGGATATCCCAGATTGGGAGATTAGTATAGAAGGGTTGGTTGAGAAGCCATTAGTCCTG
AGCTTCTGCGAAGTGCTTCAGAAGTACGACCAGATTACCGCCCCGATCACACTCGTATGTGCAGGCAACAGACGC
AAAGAACAGAACACAGTCCGGAAGTCGAAGGGCTTCTCATGGGGTGCGGCTGGTTTATCGACAGCGCTATTCACA
GGGCCTATGATGGCGGATATTCTACGCAGTGCGAAGCCACTTCGAGGAGCGAAGTATGTCTGTATGGAGGGCGCT
GATAAGCTGCCGAATGGATTTTACGGAACTTCGGTCAAATTGAACTGGGCCATGGACCCAAACCGAGGAATTATG
CTGGCTCATAAAATGAATGGCGAAGACCTTCGGCCGGATCATGGCCGCCCCTTGAGGGCAGTGGTGCCTGGCCAA
ATCGGAGGTCGGAGCGTGAAATGGCTGAAGAAGTTGATTCTGACTGATACCCCAAGCGATAACTGGTATCATATC
AATGATAACCGAGTACTCCCGACAATGGTGACGCCGGAAATGTCCTCCCAGGATCGCAAGTGGTGGACCGATGAG
CGATATGCTATTTATGAACTCAACGTCAATTCGGTGGCTGTGTATCCACAACACGAGGAAGAAATCGATATATCC
ACAGCTGGGCCCACGTATACAGTCAAAGGATATGCATACGCCGGGGGTGGCCGGAGGATAATAAAAGTGGAGATT
TCTCTAGACAGGGGCAAATCATGGCGCCTCACCGAGATCGAGTATGCAGAAGACAAATACCGTGATTTTGACGGC
GACCTGTTCGGTGGCAAGGTAGACATGTGGTGGAGGGAAGCATCTTTCTGCTGGTCTTTCTGGTCGTTGGAAGTC
CCAGTGGCAGACCTAGAGACTAGCGATGCAATCCTAGTCCGTGCAGTGGATGAGGCATTAAGCGCTATGCCGCGT
GACATGTACTGGTCTGTCTTGGGCATGATGAATAACCCCTGGTTCAGAGTGGCAATCACGAAACAAGGAAGTACG
CTGAAATTTGAACATCCCACACATCCAGCCAAAGCTGGCGGATGGATGGAAAGAGTCAAGAAGACTGGTGGTGAC
CTGCTTAATGGTAACTGGGGCGAAAGGGTTGAAGGCGAGGAGCTCGTCGAACCGGAGCCTATGCAAGAAATAAAT
ATGAAGAAAGACGGCGTGAACAGACAAATCGACCTGCAAGAGTTGAAAGCTAATAGCAGCAGCGAAAAGCCATGG
TTTGTTGTAAATGGCGAAGTGTATGATGGCACAGGCTTCCTCGAAGGCCACCCCGGAGGAGCGATCAGTATTACA
TCTTCTGCTGGTTTGGATGTATCAGAAGACTTCCTTGCAATCCACAGTGAAACTGCTAAGGCAATGATGCCGGAT
TACCATATTGGCACATTAGACAAAGCATCTCTTGAAGCGATGAAGAGCGATTCGGCTGCGGATTCCGATGAGCCA
CGCGCAGTGTTCCTTCAGTCTCGAGCATGGACAAAAGCCACTCTCACAGAGAAGAGAGATGTATCCTGGGATACA
CGGGTATTCGTGTTCGACCTGGAACATGAGAAGCAGACGCTCGGCCTACCAATCGGCCAGCATCTGATGATTAAA
GTCCAGGATCCATCCAATAACGAAGCAGTCATAAGATCCTATACGCCAATGTCAGACACAAACCTGATAGGCAAG
ATGGAGTTACTTGTGAAGGTCTACTTCCCAACGGAAAGCATTCCAGGAGGAAAAATGACCATGGCTCTCGACAAG
CTTCCCCTGAGCTCTGAGATCGAGTGCAAGGGTCCAACGGGCCGGTTTGAATACCTCGGCAACGGCCGGGTTTCG
ATCAGTGGTAAAGAACGCCAGCTCCGCTCGTTTAAGATGATCTGTGGAGGAACGGGAATCACACCAGTCTTTCAG
GTTCTGCGGGCTGTTATGCAAGACACGCAAGATCCCACGACATGTGTTGTGCTAGACGGCAACAGGCAGGAAGAA
GATATATTGTGTCGTTCGGACCTTGATGCTTACGTGGAGACTGACTGTCGGAAATGCACTGTCGTGCATACATTG
ACTCAAGGGTCGGATAGGTGGACTGGTCGTCGGGGCCGTATTTCTGAGGAACTGCTCGCAGAGTATGCGGCTCCA
GAAGAGCAGAGTATGGTTCTGGTCTGTGGGCCAGGGCCTATGGAGAAGTCTGCTCGCGGAATTCTTCTTGCCCAA
GGTTGGGCCGAGTCGGATCTTCACTTCTTCTAG
Gene >Pro_DTO377G3_2|g2099.t1
ATGGCCAGCATAACCACACAGACGATAACAGAGTCCCAAACGATCTCTCAAATAACAATCGAGAACATCATACCA
AGTCCAGGGGAGCTAGACATCCCACTTCCACCACCGTCGAAGAACCTTGTCGACATCTTGGATGTGGATAAAGGC
ACACCGGATAGCCATGTACCTCGCGATCCACGATTGATTCGGTTAACGGGAGTTCATCCATTCAATGTGGAGCCA
CCATTGACGGCTTTATACAAAGAAGGTATCTATTCCCATATGTCATAGCGAAGCTCACAAGCTAAGCGGATACCG
AAGGCTTTCTCACACCCCCGGAACTGTTCTATGTTCGGAACCACGGGCCAGTGCCCCAGGTCCGCGATGAGGATA
TCCCAGATTGGGAGATTAGTATAGAAGGGTGAGTGCGATCGAAATTATGCTCGCAGGCTTCGAACGGGAACTGAT
TGATGAGCTAGGTTGGTTGAGAAGCCATTAGTCCTGAGCTTCTGCGAAGTGCTTCAGAAGTACGACCAGATTACC
GCCCCGATCACACTCGTATGTGCAGGCAACAGACGCAAAGAACAGAACACAGTCCGGAAGTCGAAGGGCTTCTCA
TGGGGTGCGGCTGGTTTATCGACAGCGCTATTCACAGGGCCTATGATGGCGGATATTCTACGCAGTGCGAAGCCA
CTTCGAGGAGCGAAGTATGTCTGTATGGAGGGCGCTGATAAGCTGGTGAGACTTCCTATATCAAGATTTGAGGGT
TTCAGGAACCATCCTCGAGTTAAGACTGACACATTCCATAGCCGAATGGATTTTACGGAACTTCGGTCAAATTGA
ACTGGGCCATGGACCCAAACCGAGGAATTATGCTGGCTCATAAAATGAATGGCGAAGACCTTCGGCCGGATCATG
GCCGCCCCTTGAGGGCAGTGGTGCCTGGCCAAATCGGAGGTCGGAGCGTGAAATGGCTGAAGAAGTTGATTCTGA
CTGATACCCCAAGCGATAACTGGTATCATATCAATGATAACCGAGTACTCCCGTAAGTCTTACGCTAAACGATCG
CGCAGTGAGTCATGCTAACAGTTGTCAGGACAATGGTGACGCCGGAAATGTCCTCCCAGGATCGCAAGTGGTGGA
CCGATGAGCGATATGCTATTTATGAACTCAACGTCAATTCGGTGGCTGTGTATCCACAACACGAGGAAGAAATCG
ATATATCCACAGCTGGGCCCACGTATACAGTCAAAGGATATGCATACGCCGGGGGTGGCCGGAGGATAATAAAAG
TGGAGATTTCTCTAGACAGGGGCAAATGTAATTGCACCCCGGACCAAAGGATGGAACGTGGCTAACATCTCTGGT
CCTTTAGCATGGCGCCTCACCGAGATCGAGTATGCAGAAGACAAATACCGTGATTTTGACGGCGACCTGTTCGGT
GGCAAGGTAGACATGTGGTGGAGGGAAGCATCTTTCTGCTGGTCTTTCTGGTCGTTGGAAGTCCCAGTGGCAGAC
CTAGAGACTAGCGATGCAATCCTAGTCCGTGCAGTGGATGAGGCATTAAGCGCTATGCCGCGTGACATGTACTGG
TCTGTCTTGGGCATGATGAATAACCCCTGGTTCAGAGTGGCAATCACGAAACAAGGAAGTACGCTGAAATTTGAA
CATCCCACACATCCAGCCAAAGCTGGCGGATGGATGGAAAGAGTCAAGAAGACTGGTGGTGACCTGCTTAATGGT
AACTGGGGCGAAAGGGTTGAAGGCGAGGAGCTCGTCGAACCGGAGCCTATGCAAGAAATAAATATGAAGAAAGAC
GGCGTGAACAGACAAATCGACCTGCAAGAGTTGAAAGCTAATAGCAGCAGCGAAAAGCCATGGTTTGTTGTAAAT
GGCGAAGTGTATGATGGCACAGGCTTCCTCGAAGGCCACCCCGGAGGAGCGATCAGTATTACATCTTCTGCTGGT
TTGGATGTATCAGAAGACTTCCTTGCAATCCGTGAGTCGAGATTAAAATACCTTCAGACTATTGCACCGCTAATT
TGCTCTTAGACAGTGAAACTGCTAAGGCAATGATGCCGGATTACCATATTGGCACATTAGACAAAGCATCTCTTG
AAGCGATGAAGAGCGATTCGGCTGCGGATTCCGATGAGCCACGCGCAGTGTTCCTTCAGTCTCGAGCATGGACAA
AAGCCACTCTCACAGAGAAGAGAGATGTATCCTGGGATACACGGGTATTCGTGTTCGACCTGGAACATGAGAAGC
AGACGCTCGGCCTACCAATCGGCCAGCATCTGATGATTAAAGTCCAGGATCCATCCAATAACGAAGCAGTCATAA
GATCCTATACGCCAATGTCAGACACAAACCTGATAGGCAAGATGGAGTTACTTGTGAAGGTCTACTTCCCAACGG
AAAGCATTCCAGGAGGAAAAATGACCATGGCTCTCGACAAGCTTCCCCTGAGCTCTGAGATCGAGTGCAAGGGTC
CAACGGGCCGGTTTGAATACCTCGGCAACGGCCGGGTTTCGATCAGTGGTAAAGAACGCCAGCTCCGCTCGTTTA
AGATGATCTGTGGAGGAACGGGAATCACACCAGTCTTTCAGGTTCTGCGGGCTGTTATGCAAGACACGCAAGATC
CCACGACATGTGTTGTGCTAGACGGCAACAGGCAGGAAGAAGATATATTGTGTCGTTCGGACCTTGATGCTTACG
TGGAGACTGACTGTCGGAAATGCACTGTCGTGCATACATTGACTCAAGGGTCGGATAGGTGGACTGGTCGTCGGG
GCCGTATTTCTGAGGAACTGCTCGCAGAGTATGCGGCTCCAGAAGAGCAGAGTATGGTTCTGGTCTGTGGGCCAG
GGCCTATGGAGAAGTCTGCTCGCGGAATTCTTCTTGCCCAAGGTTGGGCCGAGTCGGATCTTCACTTCTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail