Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2083.t1
Gene name
Locationscaffold_02:1618478..1619312
Strand+
Gene length (bp)834
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 1.3E-07 156 231
PF13242 Hydrolase_like HAD-hyrolase-like 2.0E-05 176 241

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 20.68 8.63 32.72
5d_25C Five days - 25 degrees Celsius 17.36 6.91 27.81
7d_25C Seven days - 25 degrees Celsius 16.50 6.44 26.56
10d_25C Ten days - 25 degrees Celsius 17.26 6.85 27.67
7d_15C Seven days - 15 degrees Celsius 17.96 7.11 28.82
7d_30C Seven days - 30 degrees Celsius 12.72 4.50 20.95

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.684931 no
3d_25C 7d_25C 0.571494 no
3d_25C 7d_15C 0.753599 no
3d_25C 7d_30C 0.165132 no
3d_25C 10d_25C 0.671546 no
5d_25C 7d_25C 0.921874 no
5d_25C 7d_15C 0.951749 no
5d_25C 7d_30C 0.433647 no
5d_25C 10d_25C 0.991168 no
7d_25C 7d_15C 0.864588 no
7d_25C 7d_30C 0.523559 no
7d_25C 10d_25C 0.931464 no
7d_15C 7d_30C 0.375225 no
7d_15C 10d_25C 0.941536 no
7d_30C 10d_25C 0.448703 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2083.t1
MAEIKRPVGLLFDVGGVCVASPLQAILDYEIIRNIPSGWINFSISRTAPNGSWHKLERGDIGVDTDFFAGFNADL
ASPELWAQFQQQLQKKQGTNGSTIPPMPTVDAEWLFWEMMRVSRTTDPYIYPALKKLRESGQFLMGALSNTIIFP
DGHEYNEASEVKKQFDFFISSAHTGLRKPDPKIYQVALQEMDNLAKRRGLAGANPDDVVFFDDIGENLKGAKNAG
MRTVKVILGKTQDAVKELEKLTGLQLLEEDKARL*
Coding >Pro_DTO377G3_2|g2083.t1
ATGGCAGAGATCAAGCGACCGGTGGGCTTACTGTTCGACGTTGGAGGAGTGTGTGTTGCATCCCCGCTACAAGCT
ATTCTTGACTATGAGATTATCCGAAACATCCCATCAGGATGGATCAATTTCAGTATCTCGCGAACCGCGCCCAAC
GGTAGCTGGCACAAGCTCGAGCGAGGCGACATCGGGGTGGACACGGACTTCTTTGCGGGGTTCAATGCGGACCTG
GCAAGCCCGGAACTATGGGCGCAATTCCAACAGCAACTTCAAAAGAAACAAGGCACAAATGGTTCTACCATTCCT
CCAATGCCGACGGTGGATGCAGAATGGCTATTCTGGGAGATGATGCGGGTATCTCGCACGACAGACCCCTATATT
TACCCAGCTCTGAAGAAATTGAGAGAGTCAGGACAGTTCCTGATGGGCGCTCTATCCAACACCATTATATTCCCC
GACGGACATGAATACAATGAAGCATCCGAAGTGAAGAAGCAATTCGATTTCTTCATCTCGTCTGCGCACACGGGC
CTCCGCAAACCTGACCCCAAAATTTACCAGGTGGCGTTGCAGGAGATGGACAATTTAGCTAAGAGACGAGGACTA
GCCGGAGCTAATCCCGACGATGTTGTGTTCTTCGATGACATTGGCGAGAACCTGAAGGGGGCGAAGAACGCTGGC
ATGCGTACAGTCAAAGTCATACTTGGAAAGACCCAAGATGCGGTCAAGGAGCTGGAGAAGCTCACAGGCCTTCAG
TTGCTGGAGGAGGACAAGGCACGATTGTGA
Transcript >Pro_DTO377G3_2|g2083.t1
ATGGCAGAGATCAAGCGACCGGTGGGCTTACTGTTCGACGTTGGAGGAGTGTGTGTTGCATCCCCGCTACAAGCT
ATTCTTGACTATGAGATTATCCGAAACATCCCATCAGGATGGATCAATTTCAGTATCTCGCGAACCGCGCCCAAC
GGTAGCTGGCACAAGCTCGAGCGAGGCGACATCGGGGTGGACACGGACTTCTTTGCGGGGTTCAATGCGGACCTG
GCAAGCCCGGAACTATGGGCGCAATTCCAACAGCAACTTCAAAAGAAACAAGGCACAAATGGTTCTACCATTCCT
CCAATGCCGACGGTGGATGCAGAATGGCTATTCTGGGAGATGATGCGGGTATCTCGCACGACAGACCCCTATATT
TACCCAGCTCTGAAGAAATTGAGAGAGTCAGGACAGTTCCTGATGGGCGCTCTATCCAACACCATTATATTCCCC
GACGGACATGAATACAATGAAGCATCCGAAGTGAAGAAGCAATTCGATTTCTTCATCTCGTCTGCGCACACGGGC
CTCCGCAAACCTGACCCCAAAATTTACCAGGTGGCGTTGCAGGAGATGGACAATTTAGCTAAGAGACGAGGACTA
GCCGGAGCTAATCCCGACGATGTTGTGTTCTTCGATGACATTGGCGAGAACCTGAAGGGGGCGAAGAACGCTGGC
ATGCGTACAGTCAAAGTCATACTTGGAAAGACCCAAGATGCGGTCAAGGAGCTGGAGAAGCTCACAGGCCTTCAG
TTGCTGGAGGAGGACAAGGCACGATTGTGA
Gene >Pro_DTO377G3_2|g2083.t1
ATGGCAGAGATCAAGCGACCGGTGGGCTTACTGTTCGACGTTGGAGGAGTGTGTGTAAGTCGGCCACTTGACCCA
TAAATTAAAGATACATATCTGACGAATCTCTAGGTTGCATCCCCGCTACAAGCTATTCTTGACTATGAGATTATC
CGAAACATCCCATCAGGATGGATCAATTTCAGTATCTCGCGAACCGCGCCCAACGGTAGCTGGCACAAGCTCGAG
CGAGGCGACATCGGGGTGGACACGGACTTCTTTGCGGGGTTCAATGCGGACCTGGCAAGCCCGGAACTATGGGCG
CAATTCCAACAGCAACTTCAAAAGAAACAAGGCACAAATGGTTCTACCATTCCTCCAATGCCGACGGTGGATGCA
GAATGGCTATTCTGGGAGATGATGCGGGTATCTCGCACGACAGACCCCTATATTTACCCAGCTCTGAAGAAATTG
AGAGAGTCAGGACAGTTCCTGATGGGCGCTCTATCCAACACCATTATATTCCCCGACGGACATGAATACAATGAA
GCATCCGAAGTGAAGAAGCAATTCGATTTCTTCATCTCGTCTGCGCACACGGGCCTCCGCAAACCTGACCCCAAA
ATTTACCAGGTGGCGTTGCAGGAGATGGACAATTTAGCTAAGAGACGAGGACTAGCCGGAGCTAATCCCGACGAT
GTTGTGTTCTTCGATGACATTGGCGAGAACCTGAAGGGGGCGAAGAACGCTGGCATGCGTACAGTCAAAGTCATA
CTTGGAAAGACCCAAGATGCGGTCAAGGAGCTGGAGAAGCTCACAGGCCTTCAGTTGCTGGAGGAGGACAAGGCA
CGATTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail