Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2069.t1
Gene name
Locationscaffold_02:1583683..1584618
Strand-
Gene length (bp)935
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10173 Mit_KHE1 Mitochondrial K+-H+ exchange-related 1.4E-61 2 175

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 133 155 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 55.25 30.45 80.06
5d_25C Five days - 25 degrees Celsius 53.78 29.18 78.39
7d_25C Seven days - 25 degrees Celsius 47.28 25.06 69.51
10d_25C Ten days - 25 degrees Celsius 46.51 24.59 68.42
7d_15C Seven days - 15 degrees Celsius 67.27 38.44 96.10
7d_30C Seven days - 30 degrees Celsius 42.88 22.19 63.57

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.945497 no
3d_25C 7d_25C 0.625573 no
3d_25C 7d_15C 0.493093 no
3d_25C 7d_30C 0.387980 no
3d_25C 10d_25C 0.583605 no
5d_25C 7d_25C 0.705008 no
5d_25C 7d_15C 0.438647 no
5d_25C 7d_30C 0.468528 no
5d_25C 10d_25C 0.664488 no
7d_25C 7d_15C 0.175414 no
7d_25C 7d_30C 0.794886 no
7d_25C 10d_25C 0.970026 no
7d_15C 7d_30C 0.078320 no
7d_15C 10d_25C 0.148853 no
7d_30C 10d_25C 0.835836 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2069.t1
MRLFLIPISTKRVLVYARPLSKDLAKELSVLDRITTKAAEIWAKWEEADKGWKMHLVRWGNRVQQRIPYEEWALK
SIPSFKTQQRVNGDHGKTKVDVLFPGNAVRLERVQDVLRTVATERQELHRKKMMWCLIAAPITAPLGLIPVVPNI
PFFYLAYRGWSHWRALNGSKHLELLVGQNILNPISLPGLEQLYAKRVSGVLEGSATEPSYSEVADDIEQSEDRVL
LKMSDAKKLATILEAPELVLEAERAIIQVGERLEAAEKTKQENKDEKKDS*
Coding >Pro_DTO377G3_2|g2069.t1
ATGCGCCTGTTCCTAATTCCGATCTCCACAAAGCGAGTTCTCGTATATGCTCGGCCCCTTAGCAAGGACTTAGCG
AAGGAGCTGTCGGTCCTTGATAGGATCACAACCAAGGCGGCTGAAATATGGGCCAAGTGGGAGGAAGCCGACAAA
GGATGGAAGATGCACCTTGTTCGCTGGGGCAATCGAGTCCAGCAACGGATACCATACGAAGAATGGGCCCTCAAA
AGCATTCCTTCATTCAAGACCCAACAGCGAGTGAATGGGGATCATGGGAAGACTAAGGTGGATGTGCTGTTCCCT
GGTAACGCGGTGCGATTGGAGCGAGTTCAAGATGTACTGCGCACGGTCGCCACGGAGAGACAGGAGCTTCATCGG
AAGAAGATGATGTGGTGCTTAATAGCTGCGCCGATTACCGCCCCACTTGGATTGATACCAGTGGTTCCGAATATT
CCCTTTTTCTACTTGGCATATCGGGGCTGGTCCCACTGGCGCGCATTGAATGGTTCAAAACACCTGGAATTACTC
GTCGGACAGAATATCCTCAACCCTATCTCATTACCGGGGCTAGAACAGCTATATGCCAAACGCGTATCTGGAGTA
CTGGAAGGTTCCGCGACCGAGCCATCATATTCCGAGGTTGCCGACGACATAGAGCAGAGCGAGGATCGGGTCCTG
TTGAAGATGTCTGATGCCAAGAAGTTGGCTACGATCCTGGAAGCGCCGGAGCTTGTTTTGGAAGCTGAACGAGCG
ATTATTCAAGTCGGTGAGCGACTCGAGGCTGCAGAGAAGACTAAACAAGAGAACAAAGACGAGAAGAAGGATTCA
TGA
Transcript >Pro_DTO377G3_2|g2069.t1
ATGCGCCTGTTCCTAATTCCGATCTCCACAAAGCGAGTTCTCGTATATGCTCGGCCCCTTAGCAAGGACTTAGCG
AAGGAGCTGTCGGTCCTTGATAGGATCACAACCAAGGCGGCTGAAATATGGGCCAAGTGGGAGGAAGCCGACAAA
GGATGGAAGATGCACCTTGTTCGCTGGGGCAATCGAGTCCAGCAACGGATACCATACGAAGAATGGGCCCTCAAA
AGCATTCCTTCATTCAAGACCCAACAGCGAGTGAATGGGGATCATGGGAAGACTAAGGTGGATGTGCTGTTCCCT
GGTAACGCGGTGCGATTGGAGCGAGTTCAAGATGTACTGCGCACGGTCGCCACGGAGAGACAGGAGCTTCATCGG
AAGAAGATGATGTGGTGCTTAATAGCTGCGCCGATTACCGCCCCACTTGGATTGATACCAGTGGTTCCGAATATT
CCCTTTTTCTACTTGGCATATCGGGGCTGGTCCCACTGGCGCGCATTGAATGGTTCAAAACACCTGGAATTACTC
GTCGGACAGAATATCCTCAACCCTATCTCATTACCGGGGCTAGAACAGCTATATGCCAAACGCGTATCTGGAGTA
CTGGAAGGTTCCGCGACCGAGCCATCATATTCCGAGGTTGCCGACGACATAGAGCAGAGCGAGGATCGGGTCCTG
TTGAAGATGTCTGATGCCAAGAAGTTGGCTACGATCCTGGAAGCGCCGGAGCTTGTTTTGGAAGCTGAACGAGCG
ATTATTCAAGTCGGTGAGCGACTCGAGGCTGCAGAGAAGACTAAACAAGAGAACAAAGACGAGAAGAAGGATTCA
TGA
Gene >Pro_DTO377G3_2|g2069.t1
ATGCGCCTGTTCCTAATTCCGATCTCCACAAAGCGAGTTCTCGTATATGCTCGGCCCCTTAGCAAGGACTTAGCG
AAGGAGCTGTCGGTCCTTGATAGGATCACAACCAAGGCGGCTGAAATATGGGCCAAGTGGGAGGAAGCCGACAAA
GGATGGAAGATGCACCTTGTTCGCTGGGGCAATCGAGTCCAGCAACGGATACCATACGAAGAATGGGCCCTCAAA
AGCATTCCTTCATTCAAGACCCAACAGCGAGTGAATGGGGATCATGGGAAGACTAAGGTGGATGTGCTGTTCCCT
GGTAACGCGGTGCGATTGGAGCGAGTTCAAGATGTACTGCGCACGGTCGCCACGGAGAGACAGGAGCTTCATCGG
AAGAAGATGATGTGGTGCTTAATAGCTGCGCCGATTACCGCCCCACTTGGATTGATACCAGTGTATGTGAAAGAC
ATGAGCCTTCTCCGGTGATATGGTATACTAATAAAGAGCAGGGTTCCGAATATTCCCTTTTTCTACTTGGCATAT
CGGGGCTGGTCCCACTGGCGCGGTTAGTTTTGATCGTCTACATTGCGATGGCTCATAAAACTGACGAGAATACAG
CATTGAATGGTTCAAAACACCTGGAATTACTCGTCGGACAGAATATCCTCAACCCTATCTCATTACCGGGGCTAG
AACAGCTATATGCCAAACGCGTATCTGGAGTACTGGAAGGTTCCGCGACCGAGCCATCATATTCCGAGGTTGCCG
ACGACATAGAGCAGAGCGAGGATCGGGTCCTGTTGAAGATGTCTGATGCCAAGAAGTTGGCTACGATCCTGGAAG
CGCCGGAGCTTGTTTTGGAAGCTGAACGAGCGATTATTCAAGTCGGTGAGCGACTCGAGGCTGCAGAGAAGACTA
AACAAGAGAACAAAGACGAGAAGAAGGATTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail