Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2068.t1
Gene name
Locationscaffold_02:1582071..1583411
Strand-
Gene length (bp)1340
Transcript length (bp)1215
Coding sequence length (bp)1215
Protein length (aa) 405

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12761 End3 Actin cytoskeleton-regulatory complex protein END3 9.6E-68 192 394
PF12763 EF-hand_4 Cytoskeletal-regulatory complex EF hand 2.4E-48 4 105
PF00036 EF-hand_1 EF hand 2.6E-07 47 72

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005515 protein binding Yes
GO:0006897 endocytosis Yes
GO:0007015 actin filament organization Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0051179 localization No
GO:0097435 supramolecular fiber organization No
GO:0016043 cellular component organization No
GO:0098657 import into cell No
GO:0043169 cation binding No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0016192 vesicle-mediated transport No
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2068.t1
MATKKIEQWEIERYWEIFASLSNGQKHLNSSQAASVLRNSRLRDDQLEKVWDIADVDGDGELDFEEFCVAMRLVF
DLVNGELQDVPNVLPDWLVPESKAHLVHATRALSSGQEQFERIEDEDDSLGLKDGFDWYMKPDDKNKYAEIYDAN
RNARGQIEFQQLQPLYESLDVPDTDVRSAWNLVNPSASPAINKDATLAFLHILNFRHEGFRIPRTIPASLRASFE
HNQIDYQVDKARPAQRYGVDGDTETRSGRKAKFGDTYLGRLGVGGKGSYQPKGTDFSDTIQDEEWEKVRLRRELA
ELEKKLESANKASESRRDGPRNDGRPNWVLIKKEALSLLEYKERELRELREGTGRAKDGQDLERLREDVKAVGEQ
VEGLKKHMAQRHDVLSDLRSQIEDEKARR*
Coding >Pro_DTO377G3_2|g2068.t1
ATGGCTACTAAAAAGATTGAGCAATGGGAGATTGAGCGATATTGGGAGATCTTCGCCTCATTATCAAATGGTCAA
AAACACCTCAACAGCTCCCAGGCCGCCTCCGTGCTGAGGAACAGCCGGCTGCGCGATGATCAACTCGAGAAGGTC
TGGGACATTGCCGATGTCGACGGAGACGGAGAGCTAGATTTCGAGGAGTTCTGTGTTGCAATGCGCTTAGTCTTC
GACTTAGTGAATGGTGAACTACAAGATGTCCCAAATGTCCTGCCAGATTGGCTAGTTCCAGAGTCCAAAGCACAT
CTCGTCCATGCGACCCGCGCACTAAGCAGCGGACAGGAGCAGTTCGAGCGGATAGAAGACGAGGACGACTCGCTC
GGCCTAAAGGACGGCTTTGATTGGTATATGAAGCCCGACGACAAGAACAAGTATGCCGAGATCTACGACGCCAAC
CGGAACGCGCGCGGCCAAATAGAATTCCAACAATTACAACCGCTCTACGAATCGCTCGACGTCCCCGACACGGAC
GTCCGCTCCGCCTGGAACCTGGTCAACCCCTCCGCATCACCCGCGATAAATAAAGATGCGACGCTCGCCTTCCTG
CACATATTGAACTTCCGCCACGAGGGTTTCCGCATCCCACGCACCATCCCCGCCTCGCTGCGTGCCTCATTCGAG
CACAACCAGATTGACTACCAAGTTGATAAGGCGCGACCCGCACAGCGTTACGGCGTAGACGGTGACACCGAAACA
CGGTCAGGCCGCAAGGCCAAGTTCGGCGATACCTACCTCGGCCGTCTAGGCGTTGGTGGCAAGGGCTCGTATCAG
CCCAAGGGAACGGATTTCAGCGACACGATCCAGGACGAGGAGTGGGAGAAGGTGCGGCTGCGCCGCGAGCTTGCG
GAATTGGAGAAGAAGCTAGAATCCGCCAATAAAGCCTCCGAATCTAGGCGGGATGGGCCGCGCAACGATGGCCGG
CCCAACTGGGTTTTGATTAAGAAGGAGGCACTCTCGCTTTTGGAGTATAAGGAGCGGGAGTTGCGCGAGTTGCGT
GAGGGCACTGGCCGTGCTAAGGATGGTCAGGATTTGGAGCGACTCCGGGAGGATGTCAAGGCTGTTGGGGAACAG
GTGGAAGGGCTGAAGAAACATATGGCCCAACGGCATGATGTCCTTTCGGATCTCCGCAGCCAGATTGAGGACGAG
AAAGCTCGGCGGTGA
Transcript >Pro_DTO377G3_2|g2068.t1
ATGGCTACTAAAAAGATTGAGCAATGGGAGATTGAGCGATATTGGGAGATCTTCGCCTCATTATCAAATGGTCAA
AAACACCTCAACAGCTCCCAGGCCGCCTCCGTGCTGAGGAACAGCCGGCTGCGCGATGATCAACTCGAGAAGGTC
TGGGACATTGCCGATGTCGACGGAGACGGAGAGCTAGATTTCGAGGAGTTCTGTGTTGCAATGCGCTTAGTCTTC
GACTTAGTGAATGGTGAACTACAAGATGTCCCAAATGTCCTGCCAGATTGGCTAGTTCCAGAGTCCAAAGCACAT
CTCGTCCATGCGACCCGCGCACTAAGCAGCGGACAGGAGCAGTTCGAGCGGATAGAAGACGAGGACGACTCGCTC
GGCCTAAAGGACGGCTTTGATTGGTATATGAAGCCCGACGACAAGAACAAGTATGCCGAGATCTACGACGCCAAC
CGGAACGCGCGCGGCCAAATAGAATTCCAACAATTACAACCGCTCTACGAATCGCTCGACGTCCCCGACACGGAC
GTCCGCTCCGCCTGGAACCTGGTCAACCCCTCCGCATCACCCGCGATAAATAAAGATGCGACGCTCGCCTTCCTG
CACATATTGAACTTCCGCCACGAGGGTTTCCGCATCCCACGCACCATCCCCGCCTCGCTGCGTGCCTCATTCGAG
CACAACCAGATTGACTACCAAGTTGATAAGGCGCGACCCGCACAGCGTTACGGCGTAGACGGTGACACCGAAACA
CGGTCAGGCCGCAAGGCCAAGTTCGGCGATACCTACCTCGGCCGTCTAGGCGTTGGTGGCAAGGGCTCGTATCAG
CCCAAGGGAACGGATTTCAGCGACACGATCCAGGACGAGGAGTGGGAGAAGGTGCGGCTGCGCCGCGAGCTTGCG
GAATTGGAGAAGAAGCTAGAATCCGCCAATAAAGCCTCCGAATCTAGGCGGGATGGGCCGCGCAACGATGGCCGG
CCCAACTGGGTTTTGATTAAGAAGGAGGCACTCTCGCTTTTGGAGTATAAGGAGCGGGAGTTGCGCGAGTTGCGT
GAGGGCACTGGCCGTGCTAAGGATGGTCAGGATTTGGAGCGACTCCGGGAGGATGTCAAGGCTGTTGGGGAACAG
GTGGAAGGGCTGAAGAAACATATGGCCCAACGGCATGATGTCCTTTCGGATCTCCGCAGCCAGATTGAGGACGAG
AAAGCTCGGCGGTGA
Gene >Pro_DTO377G3_2|g2068.t1
ATGGCTACTAAAAAGATTGAGCAATGGGAGATTGAGCGATATTGGGAGATCTTCGCCTCATTATCAAATGGTCAA
AAACACCTCAACAGCTCCCAGGCCGCCTCCGTGCTGAGGAACAGCCGGCTGCGCGATGATCAACTCGAGAAGGTC
TGGGACATTGCCGATGTCGACGGAGACGGAGAGCTAGATTTCGAGGAGTTCTGTGTTGCAATGCGCTTAGTCTTC
GACTTAGTGAATGGTGTAAGTGATCCATCCTCCTGAATAATTATCGGATCGCTCTAACACAAGTCTTATCTGCAA
ACAGGAACTACAAGATGTCCCAAATGTCCTGCCAGATTGGCTAGTTCCAGAGTCCAAAGCACATCTCGTCCATGC
GACCCGCGCACTAAGCAGCGGACAGGAGCAGTTCGAGCGGATAGAAGACGAGGACGACTCGCTCGGCCTAAAGGA
CGGCTTTGATTGGTATATGAAGCCCGACGACAAGAACAAGTATGCCGAGATCTACGACGCCAACCGGAACGCGCG
CGGCCAAATAGAATGTGAGTAGCCCTTACAGCGTGCTGTGCGCGCCCAGAAAAATACCCCGCTGACAGACCCCAG
TCCAACAATTACAACCGCTCTACGAATCGCTCGACGTCCCCGACACGGACGTCCGCTCCGCCTGGAACCTGGTCA
ACCCCTCCGCATCACCCGCGATAAATAAAGATGCGACGCTCGCCTTCCTGCACATATTGAACTTCCGCCACGAGG
GTTTCCGCATCCCACGCACCATCCCCGCCTCGCTGCGTGCCTCATTCGAGCACAACCAGATTGACTACCAAGTTG
ATAAGGCGCGACCCGCACAGCGTTACGGCGTAGACGGTGACACCGAAACACGGTCAGGCCGCAAGGCCAAGTTCG
GCGATACCTACCTCGGCCGTCTAGGCGTTGGTGGCAAGGGCTCGTATCAGCCCAAGGGAACGGATTTCAGCGACA
CGATCCAGGACGAGGAGTGGGAGAAGGTGCGGCTGCGCCGCGAGCTTGCGGAATTGGAGAAGAAGCTAGAATCCG
CCAATAAAGCCTCCGAATCTAGGCGGGATGGGCCGCGCAACGATGGCCGGCCCAACTGGGTTTTGATTAAGAAGG
AGGCACTCTCGCTTTTGGAGTATAAGGAGCGGGAGTTGCGCGAGTTGCGTGAGGGCACTGGCCGTGCTAAGGATG
GTCAGGATTTGGAGCGACTCCGGGAGGATGTCAAGGCTGTTGGGGAACAGGTGGAAGGGCTGAAGAAACATATGG
CCCAACGGCATGATGTCCTTTCGGATCTCCGCAGCCAGATTGAGGACGAGAAAGCTCGGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail