Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2063.t1
Gene name
Locationscaffold_02:1566467..1567932
Strand+
Gene length (bp)1465
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 70 88 18
2 103 125 22
3 171 193 22
4 203 221 18
5 230 247 17
6 267 286 19
7 306 328 22
8 343 365 22
9 370 387 17
10 397 419 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2063.t1
MVVNRPPLHRPTDGRSQQPLLKDDRPRSRPRSSFGNYDTEGQPMLHESRRPTIRSKSPERDAALATRKKYMVASG
FLVLSLISFVVQTETASYIQNELHWKKPYCMLYMTHGSWSLLWLVQLGILRIQKRKLTWDVFWRRHVFFLRTTAQ
MVESQEVHLSTRASNQSPVRYMLKTTAFVTTALTVAGGSWYVAVNMTTPSDLTAIYNCSAFFAYAFSIPLLKEKL
RIDKVFSVAVATIGVMVVAYGDGPHKKVPKGGTDGNGGQNRLVGNIVIGVGSILYGLYEVLYKRFACPPEGTSSG
RGTIFANTFGSLIGAFTLLVLWIPLPFLHWTGWETFEWPTGEAAWMLLISVGANATFSGSFLVLISLTSPVLSSV
AALLTIFLVALVDWFRTGNSLSLASIIGGVLITVAFFMLSISTYREMNEERKKHLENDEIESDSDA*
Coding >Pro_DTO377G3_2|g2063.t1
ATGGTTGTCAATCGCCCCCCATTACACCGTCCAACCGACGGCCGCTCGCAACAGCCCCTCCTCAAAGATGACCGT
CCTCGCTCCCGCCCGCGCTCGAGCTTCGGTAATTATGACACAGAAGGCCAGCCCATGCTGCATGAATCACGAAGG
CCGACAATTCGGAGTAAAAGTCCGGAACGCGACGCTGCCCTGGCAACCCGCAAGAAATATATGGTTGCATCGGGG
TTCCTGGTGCTGAGTCTGATTAGCTTCGTGGTCCAAACGGAGACCGCTTCATACATTCAAAATGAGTTGCATTGG
AAGAAGCCGTATTGCATGCTCTATATGACCCACGGATCGTGGTCCTTGCTCTGGCTGGTCCAGCTGGGTATCCTT
CGGATACAGAAACGGAAGCTCACGTGGGATGTTTTCTGGCGGCGCCATGTCTTTTTCCTTCGTACCACTGCGCAG
ATGGTAGAATCGCAGGAAGTACATCTGAGTACTCGCGCGTCCAATCAATCGCCGGTCCGCTATATGCTGAAGACC
ACCGCCTTTGTGACTACTGCTCTCACCGTCGCTGGAGGATCATGGTACGTGGCAGTCAACATGACCACTCCCAGC
GACCTTACGGCGATCTATAACTGCTCGGCGTTCTTCGCATATGCCTTTTCGATTCCGCTATTGAAGGAGAAACTC
CGAATTGACAAGGTCTTTTCCGTGGCCGTGGCTACCATCGGCGTCATGGTCGTTGCCTATGGGGATGGGCCTCAT
AAGAAGGTCCCGAAAGGAGGCACAGATGGCAACGGGGGACAGAACCGATTGGTCGGAAACATTGTTATCGGCGTT
GGAAGTATTCTCTATGGCCTTTACGAGGTTCTCTATAAACGCTTTGCCTGTCCTCCGGAAGGTACCAGCTCTGGC
CGGGGTACGATCTTTGCCAATACTTTTGGCAGTCTAATAGGGGCTTTCACCCTGTTGGTACTATGGATCCCATTA
CCATTTCTGCACTGGACAGGATGGGAGACATTTGAATGGCCGACTGGCGAAGCAGCATGGATGCTGCTCATTTCC
GTGGGTGCCAATGCTACGTTCTCGGGCTCTTTCCTTGTGCTCATCTCCCTCACATCGCCCGTCCTATCCTCAGTC
GCCGCGCTCCTTACTATTTTCCTCGTCGCTCTGGTGGACTGGTTCCGAACTGGGAACTCACTTTCTCTAGCCTCG
ATTATTGGAGGCGTCTTGATTACGGTGGCATTTTTCATGCTGAGCATCAGCACGTATAGAGAGATGAATGAGGAG
CGGAAGAAGCATCTAGAGAACGATGAGATCGAGTCTGACAGTGATGCATAG
Transcript >Pro_DTO377G3_2|g2063.t1
ATGGTTGTCAATCGCCCCCCATTACACCGTCCAACCGACGGCCGCTCGCAACAGCCCCTCCTCAAAGATGACCGT
CCTCGCTCCCGCCCGCGCTCGAGCTTCGGTAATTATGACACAGAAGGCCAGCCCATGCTGCATGAATCACGAAGG
CCGACAATTCGGAGTAAAAGTCCGGAACGCGACGCTGCCCTGGCAACCCGCAAGAAATATATGGTTGCATCGGGG
TTCCTGGTGCTGAGTCTGATTAGCTTCGTGGTCCAAACGGAGACCGCTTCATACATTCAAAATGAGTTGCATTGG
AAGAAGCCGTATTGCATGCTCTATATGACCCACGGATCGTGGTCCTTGCTCTGGCTGGTCCAGCTGGGTATCCTT
CGGATACAGAAACGGAAGCTCACGTGGGATGTTTTCTGGCGGCGCCATGTCTTTTTCCTTCGTACCACTGCGCAG
ATGGTAGAATCGCAGGAAGTACATCTGAGTACTCGCGCGTCCAATCAATCGCCGGTCCGCTATATGCTGAAGACC
ACCGCCTTTGTGACTACTGCTCTCACCGTCGCTGGAGGATCATGGTACGTGGCAGTCAACATGACCACTCCCAGC
GACCTTACGGCGATCTATAACTGCTCGGCGTTCTTCGCATATGCCTTTTCGATTCCGCTATTGAAGGAGAAACTC
CGAATTGACAAGGTCTTTTCCGTGGCCGTGGCTACCATCGGCGTCATGGTCGTTGCCTATGGGGATGGGCCTCAT
AAGAAGGTCCCGAAAGGAGGCACAGATGGCAACGGGGGACAGAACCGATTGGTCGGAAACATTGTTATCGGCGTT
GGAAGTATTCTCTATGGCCTTTACGAGGTTCTCTATAAACGCTTTGCCTGTCCTCCGGAAGGTACCAGCTCTGGC
CGGGGTACGATCTTTGCCAATACTTTTGGCAGTCTAATAGGGGCTTTCACCCTGTTGGTACTATGGATCCCATTA
CCATTTCTGCACTGGACAGGATGGGAGACATTTGAATGGCCGACTGGCGAAGCAGCATGGATGCTGCTCATTTCC
GTGGGTGCCAATGCTACGTTCTCGGGCTCTTTCCTTGTGCTCATCTCCCTCACATCGCCCGTCCTATCCTCAGTC
GCCGCGCTCCTTACTATTTTCCTCGTCGCTCTGGTGGACTGGTTCCGAACTGGGAACTCACTTTCTCTAGCCTCG
ATTATTGGAGGCGTCTTGATTACGGTGGCATTTTTCATGCTGAGCATCAGCACGTATAGAGAGATGAATGAGGAG
CGGAAGAAGCATCTAGAGAACGATGAGATCGAGTCTGACAGTGATGCATAG
Gene >Pro_DTO377G3_2|g2063.t1
ATGGTTGTCAATCGCCCCCCATTACACCGTCCAACCGACGGCCGCTCGCAACAGCCCCTCCTCAAAGATGACCGT
CCTCGCTCCCGCCCGCGCTCGAGCTTCGGTAATTATGACACAGAAGGCCAGCCCATGCTGCATGAATCACGAAGG
CCGACAATTCGGAGTAAAAGTCCGGAACGCGACGCTGCCCTGGCAACCCGCAAGAAATATATGGTTGCATCGGGG
TTCCTGGTGCTGAGTCTGATTAGCTTCGTGGTCCAAACGGAGACCGCTTCATACATTCAAAATGAGTTGCATTGG
AAGAAGCCGTATTGCATGCTGTAAGTCCGAGCGCAAAGATAGCGACAAGCCCATGCGGAACCTCTTTCCCGGAAT
GTAATCGCTTACCATTTCCTTTCCCTATGCAGCTATATGACCCACGGATCGTGGTCCTTGCTCTGGCTGGTCCAG
CTGGGTATCCTTCGGATACAGAAACGGAAGCTCACGTGGGATGTTTTCTGGCGGCGCCATGTCTTTTTCCTTCGT
ACCACTGCGCAGATGGTAGAATCGCAGGAAGTACATCTGAGTACTCGCGCGTCCAATCAATCGCCGGTCCGCTAT
ATGCTGAAGACCACCGCCTTTGTGACTACTGCTCTCACCGTCGCTGGAGGATCATGGTACGTGGCAGTCAACATG
ACCACTCCCAGCGACCTTACGGCGATCTATAACTGCTCGGCGTTCTTCGCATATGCCTTTTCGATTCCGCTATTG
AAGGAGAAACTCCGAATTGACAAGGTCTTTTCCGTGGCCGTGGCTACCATCGGCGTCATGGTCGTTGCCTATGGG
GATGGGCCTCATAAGAAGGTCCCGAAAGGAGGCACAGATGGCAACGGGGGACAGAACCGATTGGTCGGAAACATT
GTTATCGGCGTTGGAAGTATTCTCTATGGCCTTTACGAGGTTCTCTATAAACGCTTTGCCTGTCCTCCGGAAGGT
ACCAGCTCTGGCCGGGGTACGATCTTTGCCAATACTTTTGGCAGTCTAATAGGGGCTTTCACCCTGTTGGTACTA
TGGATCCCATTACCATTTCTGCACTGGACAGGATGGGAGACATTTGAATGGCCGACTGGCGAAGCAGCATGGATG
CTGCTCATTTCCGTGGGTGCCAATGCTAGTAAGTACCACACCAGCGTTCAAAGCAGACACAGAAGCTAACACTAA
GATAGCGTTCTCGGGCTCTTTCCTTGTGCTCATCTCCCTCACATCGCCCGTCCTATCCTCAGTCGCCGCGCTCCT
TACTATTTTCCTCGTCGCTCTGGTGGACTGGTTCCGAACTGGGAACTCACTTTCTCTAGCCTCGATTATTGGAGG
CGTCTTGATTACGGTGGCATTTTTCATGCTGAGCATCAGCACGTATAGAGAGATGAATGAGGAGCGGAAGAAGCA
TCTAGAGAACGATGAGATCGAGTCTGACAGTGATGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail