Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2060.t1
Gene name
Locationscaffold_02:1561216..1562901
Strand-
Gene length (bp)1685
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00091 Tubulin Tubulin/FtsZ family, GTPase domain 2.0E-68 4 214
PF03953 Tubulin_C Tubulin C-terminal domain 6.2E-43 264 392
PF10644 Misat_Tub_SegII Misato Segment II tubulin-like domain 6.9E-08 3 75

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0017111 nucleoside-triphosphatase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016462 pyrophosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2060.t1
MPREIITIQAGQCGNNVGSQFWQQLCQEHGISADGNLEEHATDGAAGDRKDVFFYQSDDTRYIPRAILLDLEPRV
LNAIQTGPYKNIYNPENFFVGQQGIGAGNNWGTGYAAGEGVQEEIFDMIDREADGSDSLEGFMLLHSIAGGTGSG
LGSFILERMNDRFPKKLIQTYSVFPDTQSDVVVNPYNSLLAMRRLTQDADSVVVLDNGALSRIVADRLHVQEPSF
HQTNQLVSTVMSASTTTLRYPGYMHNDLAGIIASLIPTPRSHFLLTSYTPFTGANIEQARTVRKTTVLDVMRRLL
QPKNRMVSVNPSKSSCYISILNIIQGEADPTDVHKSLLRIRERRLATFIPWGPASIQVALTKKSPYIEETGHRVS
GLMLANHTSVATLFKRIVKHYDMLRKRNAFLDSYKKEAPFADGLGEFDEARAVVMDLIGEYEAAEREDYLDPDAG
KANELGV*
Coding >Pro_DTO377G3_2|g2060.t1
ATGCCAAGAGAAATCATCACAATCCAAGCCGGCCAGTGCGGCAACAACGTTGGCAGCCAGTTCTGGCAGCAGCTG
TGCCAGGAGCACGGGATCAGCGCAGATGGAAACCTGGAGGAGCATGCGACTGACGGGGCGGCCGGTGATCGCAAG
GATGTCTTCTTCTACCAGAGTGACGACACAAGGTACATCCCTCGAGCGATTCTCCTCGACTTAGAACCCAGGGTC
CTCAACGCCATCCAGACTGGCCCCTACAAGAATATCTACAACCCCGAGAACTTCTTCGTCGGACAACAAGGTATC
GGAGCTGGAAACAATTGGGGTACCGGATATGCTGCAGGCGAGGGCGTGCAAGAGGAGATTTTCGATATGATTGAC
CGCGAAGCAGACGGAAGTGACTCACTAGAGGGTTTTATGCTTCTACATTCGATCGCAGGAGGAACAGGCTCTGGA
CTGGGTAGTTTCATCCTCGAACGCATGAACGATCGATTCCCGAAGAAACTCATTCAAACCTACTCTGTCTTCCCG
GACACGCAGTCCGATGTCGTCGTCAACCCTTACAACAGCTTGCTGGCCATGCGCCGATTGACCCAGGATGCCGAC
TCCGTGGTCGTCCTGGACAATGGCGCTCTGTCACGAATTGTCGCTGATCGGCTGCACGTCCAAGAGCCCTCGTTC
CACCAAACCAACCAACTCGTTTCTACGGTGATGTCTGCATCTACAACCACGCTCCGATACCCTGGATACATGCAC
AACGATCTCGCCGGGATCATCGCCTCGCTCATCCCCACGCCACGCAGCCACTTCCTTCTCACATCATACACACCG
TTCACGGGCGCCAACATCGAGCAAGCCAGGACGGTGCGAAAGACCACCGTCCTAGACGTCATGCGCCGTCTTCTA
CAGCCTAAGAACCGCATGGTCTCGGTCAACCCCAGCAAGTCCAGCTGCTACATCAGCATCCTCAACATCATCCAG
GGCGAAGCCGACCCGACCGACGTGCACAAGTCACTCCTGCGCATCCGGGAGCGTCGCCTCGCTACCTTCATCCCC
TGGGGCCCTGCCAGTATCCAGGTGGCTCTCACAAAGAAATCGCCGTATATTGAGGAAACCGGACATCGCGTCAGC
GGGCTGATGCTGGCCAACCACACCTCTGTCGCGACACTCTTCAAGCGCATTGTGAAGCACTACGACATGCTCCGC
AAGCGAAATGCGTTCTTGGATTCCTACAAGAAGGAAGCTCCGTTTGCTGACGGACTTGGCGAATTTGACGAGGCA
CGGGCGGTTGTGATGGATCTGATCGGCGAGTACGAGGCAGCGGAGCGAGAGGACTACTTGGACCCGGATGCAGGC
AAGGCAAACGAGCTCGGAGTCTGA
Transcript >Pro_DTO377G3_2|g2060.t1
ATGCCAAGAGAAATCATCACAATCCAAGCCGGCCAGTGCGGCAACAACGTTGGCAGCCAGTTCTGGCAGCAGCTG
TGCCAGGAGCACGGGATCAGCGCAGATGGAAACCTGGAGGAGCATGCGACTGACGGGGCGGCCGGTGATCGCAAG
GATGTCTTCTTCTACCAGAGTGACGACACAAGGTACATCCCTCGAGCGATTCTCCTCGACTTAGAACCCAGGGTC
CTCAACGCCATCCAGACTGGCCCCTACAAGAATATCTACAACCCCGAGAACTTCTTCGTCGGACAACAAGGTATC
GGAGCTGGAAACAATTGGGGTACCGGATATGCTGCAGGCGAGGGCGTGCAAGAGGAGATTTTCGATATGATTGAC
CGCGAAGCAGACGGAAGTGACTCACTAGAGGGTTTTATGCTTCTACATTCGATCGCAGGAGGAACAGGCTCTGGA
CTGGGTAGTTTCATCCTCGAACGCATGAACGATCGATTCCCGAAGAAACTCATTCAAACCTACTCTGTCTTCCCG
GACACGCAGTCCGATGTCGTCGTCAACCCTTACAACAGCTTGCTGGCCATGCGCCGATTGACCCAGGATGCCGAC
TCCGTGGTCGTCCTGGACAATGGCGCTCTGTCACGAATTGTCGCTGATCGGCTGCACGTCCAAGAGCCCTCGTTC
CACCAAACCAACCAACTCGTTTCTACGGTGATGTCTGCATCTACAACCACGCTCCGATACCCTGGATACATGCAC
AACGATCTCGCCGGGATCATCGCCTCGCTCATCCCCACGCCACGCAGCCACTTCCTTCTCACATCATACACACCG
TTCACGGGCGCCAACATCGAGCAAGCCAGGACGGTGCGAAAGACCACCGTCCTAGACGTCATGCGCCGTCTTCTA
CAGCCTAAGAACCGCATGGTCTCGGTCAACCCCAGCAAGTCCAGCTGCTACATCAGCATCCTCAACATCATCCAG
GGCGAAGCCGACCCGACCGACGTGCACAAGTCACTCCTGCGCATCCGGGAGCGTCGCCTCGCTACCTTCATCCCC
TGGGGCCCTGCCAGTATCCAGGTGGCTCTCACAAAGAAATCGCCGTATATTGAGGAAACCGGACATCGCGTCAGC
GGGCTGATGCTGGCCAACCACACCTCTGTCGCGACACTCTTCAAGCGCATTGTGAAGCACTACGACATGCTCCGC
AAGCGAAATGCGTTCTTGGATTCCTACAAGAAGGAAGCTCCGTTTGCTGACGGACTTGGCGAATTTGACGAGGCA
CGGGCGGTTGTGATGGATCTGATCGGCGAGTACGAGGCAGCGGAGCGAGAGGACTACTTGGACCCGGATGCAGGC
AAGGCAAACGAGCTCGGAGTCTGA
Gene >Pro_DTO377G3_2|g2060.t1
ATGCCAAGGTTTGTTCATTCTTCCGAGTCAAGCATAATTGACAGGTCTCTCTCCAGCTTGAATACCGATGCTGAT
ATTGGTGGCAATTGCAGAGAAATCATCACAATCCAAGCCGGCCAGTGCGGCAACAACGGTATGTGGCTCAACTCT
GCGATCCATTCCACGATCGTTGATCTAGTCATTTGAAACGGAGCACGAGAAAATATAGTTCACGTCTAACATTCG
TTCTATCTAGTTGGCAGCCAGTTCTGGCAGCAGCTGTGCCAGGAGCACGGGATCAGCGCAGATGGAAACCTGGAG
GAGCATGCGACTGACGGGGCGGCCGGTGATCGCAAGGATGTCTTCTTCTACCAGGTGTGTATAGGAAGCTTGCGA
GGAAAATATAGGCTTGGTGGACAAGAACACTGGCTAACATATGGCAGAGTGACGACACAAGGTACATCCCTCGAG
CGATTCTCCTCGACTTAGAACCCAGGGTAGGCCTCACCGATATATCAAATCGACCACGATGATTAACGCATAGAT
TGTTCCAGGTCCTCAACGCCATCCAGACTGGCCCCTACAAGAATATCTACAACCCCGAGAACTTCTTCGTCGGAC
AACAAGGTATCGGAGCTGGAAACAATTGGGGTACCGGATATGCTGCAGGCGAGGGCGTGCAAGAGGAGATTTTCG
ATATGATTGACCGCGAAGCAGACGGAAGTGACTCACTAGAGGGTTTTATGCTTCTACATTCGATCGCAGGAGGAA
CAGGCTCTGGACTGGGTAGTTTCATCCTCGAACGCATGAACGATCGATTCCCGAAGAAACTCATTCAAACCTACT
CTGTCTTCCCGGACACGCAGTCCGATGTCGTCGTCAACCCTTACAACAGCTTGCTGGCCATGCGCCGATTGACCC
AGGATGCCGACTCCGTGGTCGTCCTGGACAATGGCGCTCTGTCACGAATTGTCGCTGATCGGCTGCACGTCCAAG
AGCCCTCGTTCCACCAAACCAACCAACTCGTTTCTACGGTGATGTCTGCATCTACAACCACGCTCCGATACCCTG
GATACATGCACAACGATCTCGCCGGGATCATCGCCTCGCTCATCCCCACGCCACGCAGCCACTTCCTTCTCACAT
CATACACACCGTTCACGGGCGCCAACATCGAGCAAGCCAGGACGGTGCGAAAGACCACCGTCCTAGACGTCATGC
GCCGTCTTCTACAGCCTAAGAACCGCATGGTCTCGGTCAACCCCAGCAAGTCCAGCTGCTACATCAGCATCCTCA
ACATCATCCAGGGCGAAGCCGACCCGACCGACGTGCACAAGTCACTCCTGCGCATCCGGGAGCGTCGCCTCGCTA
CCTTCATCCCCTGGGGCCCTGCCAGTATCCAGGTGGCTCTCACAAAGAAATCGCCGTATATTGAGGAAACCGGAC
ATCGCGTCAGCGGGCTGATGCTGGCCAACCACACCTCTGTCGCGACACTCTTCAAGCGCATTGTGAAGCACTACG
ACATGCTCCGCAAGCGAAATGCGTTCTTGGATTCCTACAAGAAGGAAGCTCCGTTTGCTGACGGACTTGGCGAAT
TTGACGAGGCACGGGCGGTTGTGATGGATCTGATCGGCGAGTACGAGGCAGCGGAGCGAGAGGACTACTTGGACC
CGGATGCAGGCAAGGCAAACGAGCTCGGAGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail