Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2055.t1
Gene name
Locationscaffold_02:1551439..1552693
Strand+
Gene length (bp)1254
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein 9.8E-109 58 352

GO

GO Term Description Terminal node
GO:0019211 phosphatase activator activity Yes
GO:0030234 enzyme regulator activity No
GO:0098772 molecular function regulator activity No
GO:0019208 phosphatase regulator activity No
GO:0008047 enzyme activator activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 70.32 42.26 98.38
5d_25C Five days - 25 degrees Celsius 83.73 50.82 116.63
7d_25C Seven days - 25 degrees Celsius 81.81 49.75 113.88
10d_25C Ten days - 25 degrees Celsius 107.43 65.85 149.00
7d_15C Seven days - 15 degrees Celsius 122.39 74.46 170.32
7d_30C Seven days - 30 degrees Celsius 69.90 41.91 97.90

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.504981 no
3d_25C 7d_25C 0.578654 no
3d_25C 7d_15C 0.005626 yes
3d_25C 7d_30C 0.987112 no
3d_25C 10d_25C 0.047134 yes
5d_25C 7d_25C 0.948586 no
5d_25C 7d_15C 0.078462 no
5d_25C 7d_30C 0.491467 no
5d_25C 10d_25C 0.283136 no
7d_25C 7d_15C 0.060029 no
7d_25C 7d_30C 0.557995 no
7d_25C 10d_25C 0.224884 no
7d_15C 7d_30C 0.007779 yes
7d_15C 10d_25C 0.625912 no
7d_30C 10d_25C 0.041603 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2055.t1
MASQAPLPSPTGKVDLSKKLSELRSNSRRGNPSSRDLTPATPPLPSPPDLSGHQYQQPIRRILSSKDHELFLASP
TYKLVLAFIFGLTDSVRGHSIPDLQKKPQSESISKVLSVITQIRALLAKNPPIDQGGSRFGNPAFRALCDDVSAQ
SASWHTNILGLKDSGAIEEASTYLIHCLGSRERIDYGSGHELNFMMWLLCLYQLGLLPASDFPAVVIKVYVEYMH
LMREIQSAYYLEPAGSHGVWGLDDYHFLPFLFGASQLVGHPYITPLGIHNTATLDEEGDNYLYLDQVRWVESVKL
VKGLRWHSPMLDDISGSKNWAKVESGMKKMFVKEVLGKLPIMQHFLFGSLIPAAEGMTDSSERDAEHEHAHGHDH
PHESSDWFGDCCGIKVPSTVAAGAEMRKRMGGGSDLRPIPFD*
Coding >Pro_DTO377G3_2|g2055.t1
ATGGCGTCACAGGCACCTTTACCATCTCCTACGGGGAAGGTCGATCTCTCGAAAAAGCTCTCTGAGTTACGGTCA
AATAGCCGAAGGGGAAACCCCAGTTCCCGAGATCTGACTCCAGCAACCCCTCCTCTCCCTTCGCCGCCCGACCTC
TCCGGCCACCAGTACCAGCAACCAATCCGCCGCATCCTATCTTCTAAAGACCATGAGCTCTTCCTCGCATCGCCG
ACCTATAAACTTGTCCTCGCCTTTATATTCGGGCTAACTGATTCTGTGCGGGGGCATTCTATCCCGGACCTCCAG
AAAAAGCCTCAATCCGAATCCATCTCCAAGGTCCTCTCAGTCATCACTCAAATACGCGCCCTCCTAGCCAAAAAC
CCGCCAATTGACCAGGGTGGATCCCGATTCGGCAACCCCGCCTTCCGAGCATTGTGCGACGATGTAAGCGCCCAG
AGCGCATCATGGCACACCAACATTCTGGGGTTGAAAGACTCTGGCGCAATCGAAGAAGCGTCGACATATTTAATC
CACTGCCTGGGCTCACGGGAGCGGATTGACTACGGCTCCGGCCATGAACTCAACTTCATGATGTGGCTGCTATGC
CTGTACCAGCTAGGTCTTCTCCCCGCCAGCGACTTCCCCGCTGTCGTGATCAAGGTCTATGTCGAGTACATGCAT
CTCATGCGCGAGATCCAGTCAGCTTACTACCTCGAGCCTGCTGGATCGCACGGTGTCTGGGGTCTGGATGACTAC
CATTTCCTGCCGTTCTTGTTCGGAGCTAGCCAGCTTGTCGGGCACCCGTATATTACTCCGCTGGGTATTCATAAC
ACAGCTACTTTAGATGAAGAGGGTGATAACTATCTCTATCTGGATCAGGTCCGATGGGTTGAGAGTGTCAAATTG
GTGAAGGGACTGCGTTGGCATAGCCCAATGCTGGACGATATCTCTGGTTCTAAGAATTGGGCCAAGGTTGAGAGC
GGCATGAAGAAGATGTTCGTTAAGGAAGTGCTGGGAAAACTTCCTATTATGCAACATTTCTTGTTCGGAAGTCTT
ATACCTGCTGCCGAAGGCATGACCGATTCTTCTGAGAGAGATGCTGAGCATGAGCATGCCCATGGCCACGACCAT
CCTCACGAGAGTTCAGACTGGTTCGGTGACTGCTGCGGCATCAAGGTACCCAGTACCGTGGCTGCGGGCGCTGAG
ATGCGTAAGCGTATGGGCGGCGGATCGGACCTGCGCCCAATTCCTTTCGATTAA
Transcript >Pro_DTO377G3_2|g2055.t1
ATGGCGTCACAGGCACCTTTACCATCTCCTACGGGGAAGGTCGATCTCTCGAAAAAGCTCTCTGAGTTACGGTCA
AATAGCCGAAGGGGAAACCCCAGTTCCCGAGATCTGACTCCAGCAACCCCTCCTCTCCCTTCGCCGCCCGACCTC
TCCGGCCACCAGTACCAGCAACCAATCCGCCGCATCCTATCTTCTAAAGACCATGAGCTCTTCCTCGCATCGCCG
ACCTATAAACTTGTCCTCGCCTTTATATTCGGGCTAACTGATTCTGTGCGGGGGCATTCTATCCCGGACCTCCAG
AAAAAGCCTCAATCCGAATCCATCTCCAAGGTCCTCTCAGTCATCACTCAAATACGCGCCCTCCTAGCCAAAAAC
CCGCCAATTGACCAGGGTGGATCCCGATTCGGCAACCCCGCCTTCCGAGCATTGTGCGACGATGTAAGCGCCCAG
AGCGCATCATGGCACACCAACATTCTGGGGTTGAAAGACTCTGGCGCAATCGAAGAAGCGTCGACATATTTAATC
CACTGCCTGGGCTCACGGGAGCGGATTGACTACGGCTCCGGCCATGAACTCAACTTCATGATGTGGCTGCTATGC
CTGTACCAGCTAGGTCTTCTCCCCGCCAGCGACTTCCCCGCTGTCGTGATCAAGGTCTATGTCGAGTACATGCAT
CTCATGCGCGAGATCCAGTCAGCTTACTACCTCGAGCCTGCTGGATCGCACGGTGTCTGGGGTCTGGATGACTAC
CATTTCCTGCCGTTCTTGTTCGGAGCTAGCCAGCTTGTCGGGCACCCGTATATTACTCCGCTGGGTATTCATAAC
ACAGCTACTTTAGATGAAGAGGGTGATAACTATCTCTATCTGGATCAGGTCCGATGGGTTGAGAGTGTCAAATTG
GTGAAGGGACTGCGTTGGCATAGCCCAATGCTGGACGATATCTCTGGTTCTAAGAATTGGGCCAAGGTTGAGAGC
GGCATGAAGAAGATGTTCGTTAAGGAAGTGCTGGGAAAACTTCCTATTATGCAACATTTCTTGTTCGGAAGTCTT
ATACCTGCTGCCGAAGGCATGACCGATTCTTCTGAGAGAGATGCTGAGCATGAGCATGCCCATGGCCACGACCAT
CCTCACGAGAGTTCAGACTGGTTCGGTGACTGCTGCGGCATCAAGGTACCCAGTACCGTGGCTGCGGGCGCTGAG
ATGCGTAAGCGTATGGGCGGCGGATCGGACCTGCGCCCAATTCCTTTCGATTAA
Gene >Pro_DTO377G3_2|g2055.t1
ATGGCGTCACAGGCACCTTTACCATCTCCTACGGGGAAGGTCGATCTCTCGAAAAAGCTCTCTGAGTTACGGTCA
AATAGCCGAAGGGGAAACCCCAGTTCCCGAGATCTGACTCCAGCAACCCCTCCTCTCCCTTCGCCGCCCGACCTC
TCCGGCCACCAGTACCAGCAACCAATCCGCCGCATCCTATCTTCTAAAGACCATGAGCTCTTCCTCGCATCGCCG
ACCTATAAACTTGTCCTCGCCTTTATATTCGGGCTAACTGATTCTGTGCGGGGGCATTCTATCCCGGACCTCCAG
AAAAAGCCTCAATCCGAATCCATCTCCAAGGTCCTCTCAGTCATCACTCAAATACGCGCCCTCCTAGCCAAAAAC
CCGCCAATTGACCAGGGTGGATCCCGATTCGGCAACCCCGCCTTCCGAGCATTGTGCGACGATGTAAGCGCCCAG
AGCGCATCATGGCACACCAACATTCTGGGGTTGAAAGACTCTGGCGCAATCGAAGAAGCGTCGACATATTTAATC
CACTGCCTGGGCTCACGGGAGCGGATTGACTACGGCTCCGGCCATGAACTCAACTTCATGATGTGGCTGCTATGC
CTGTACCAGCTAGGTCTTCTCCCCGCCAGCGACTTCCCCGCTGTCGTGATCAAGGTCTATGTCGAGTACATGCAT
CTCATGCGCGAGATCCAGTCAGCTTACTACCTCGAGCCTGCTGGATCGCACGGTGTCTGGGGTCTGGATGACTAC
CATTTCCTGCCGTTCTTGTTCGGAGCTAGCCAGCTTGTCGGGCACCCGTATATTACTCCGCTGGGTATTCATAAC
ACAGCTACTTTAGATGAAGAGGGTGATAACTATCTCTATCTGGATCAGGTCCGATGGGTTGAGAGTGTCAAATTG
GTGAAGGGACTGCGTTGGCATAGCCCAATGCTGGACGATATCTCTGGTTCTAAGAATTGGGCCAAGGTTGAGAGC
GGCATGAAGAAGATGTTCGTTAAGGAAGTGCTGGGAAAACTTCCTATTATGCAACATTTCTTGTTCGGAAGTCTT
ATACCTGCTGCCGAAGGCATGACCGATTCTTCTGAGAGAGATGCTGAGCATGAGCATGCCCATGGCCACGACCAT
CCTCACGAGAGTTCAGACTGGTTCGGTGACTGCTGCGGCATCAAGGTACCCAGTACCGTGGCTGCGGGCGCTGAG
ATGCGTAAGCGTATGGGCGGCGGATCGGACCTGCGCCCAATTCCTTTCGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail