Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2044.t1
Gene name
Locationscaffold_02:1524452..1525604
Strand+
Gene length (bp)1152
Transcript length (bp)888
Coding sequence length (bp)888
Protein length (aa) 296

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04733 Coatomer_E Coatomer epsilon subunit 4.5E-58 9 289

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 100.07 59.89 140.25
5d_25C Five days - 25 degrees Celsius 69.32 39.13 99.51
7d_25C Seven days - 25 degrees Celsius 56.74 30.87 82.61
10d_25C Ten days - 25 degrees Celsius 38.94 19.54 58.33
7d_15C Seven days - 15 degrees Celsius 76.98 42.40 111.56
7d_30C Seven days - 30 degrees Celsius 65.52 36.37 94.67

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.106607 no
3d_25C 7d_25C 0.011688 yes
3d_25C 7d_15C 0.310548 no
3d_25C 7d_30C 0.059704 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.487538 no
5d_25C 7d_15C 0.746641 no
5d_25C 7d_30C 0.876879 no
5d_25C 10d_25C 0.015268 yes
7d_25C 7d_15C 0.258414 no
7d_25C 7d_30C 0.652739 no
7d_25C 10d_25C 0.154640 no
7d_15C 7d_30C 0.595104 no
7d_15C 10d_25C 0.004045 yes
7d_30C 10d_25C 0.032181 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2044.t1
MDPFSAEGELLNIHSAFHSGQYQNVIDFETAALSPENQLPAQVLRLRAQIALGQFEESLAEPSIEEDSPDLSAVR
ALALQSSGKTDAALQLAQELAENYPENNTVQVLAATVLQAQGHSEEALALLSKHQGNLEAVSLIVQIHLVQNRTD
LALKEVQAAKRWGQDSLLVNVAESWVGLRVGGDKYQSAFYVFEELASAPGTSAPLSIVGQAIAEIHLGRLPEAEA
ALTAALETYPTDVELIANSIVLNVLAGKQTEDLESRLQQVQPAHPLLTDIQEKSEFFDTAAAKFSAKVSS*
Coding >Pro_DTO377G3_2|g2044.t1
ATGGATCCCTTTTCTGCAGAGGGCGAGCTCCTCAACATCCACAGCGCCTTCCACTCAGGCCAATACCAGAATGTG
ATTGACTTCGAGACCGCCGCGCTCTCCCCCGAGAACCAGCTCCCCGCTCAAGTCCTCCGACTCCGCGCCCAGATT
GCCCTTGGCCAATTCGAAGAAAGCCTCGCCGAGCCCTCCATCGAAGAGGACAGCCCTGACCTCTCCGCCGTCAGG
GCCCTGGCACTGCAGTCCTCCGGCAAAACAGACGCTGCCCTGCAGCTCGCACAAGAGCTCGCAGAGAACTACCCC
GAAAACAACACGGTGCAGGTTCTTGCTGCTACTGTGCTCCAGGCCCAGGGACACAGCGAGGAGGCGCTGGCGCTG
CTGTCCAAGCACCAGGGTAACCTCGAGGCCGTCTCCCTCATTGTCCAGATCCATCTCGTACAAAACCGGACCGAT
CTCGCGCTCAAGGAGGTTCAGGCTGCCAAGCGCTGGGGTCAGGATTCGCTGCTGGTCAACGTTGCCGAGTCGTGG
GTTGGCTTGAGAGTTGGCGGCGACAAGTACCAGTCTGCTTTCTACGTCTTCGAGGAGCTCGCATCCGCACCCGGT
ACCTCCGCACCGCTATCTATCGTTGGTCAGGCCATCGCTGAGATCCACCTGGGTCGTCTTCCTGAGGCTGAGGCT
GCCCTCACCGCTGCCCTTGAGACATACCCTACCGACGTGGAGTTGATTGCCAATAGCATTGTTTTGAATGTGTTG
GCTGGCAAGCAGACCGAGGACCTGGAGTCCCGGCTACAGCAGGTCCAGCCCGCGCACCCCCTTCTCACCGATATC
CAGGAGAAGAGCGAGTTTTTCGATACTGCGGCGGCAAAGTTCTCTGCTAAGGTCTCATCGTAG
Transcript >Pro_DTO377G3_2|g2044.t1
ATGGATCCCTTTTCTGCAGAGGGCGAGCTCCTCAACATCCACAGCGCCTTCCACTCAGGCCAATACCAGAATGTG
ATTGACTTCGAGACCGCCGCGCTCTCCCCCGAGAACCAGCTCCCCGCTCAAGTCCTCCGACTCCGCGCCCAGATT
GCCCTTGGCCAATTCGAAGAAAGCCTCGCCGAGCCCTCCATCGAAGAGGACAGCCCTGACCTCTCCGCCGTCAGG
GCCCTGGCACTGCAGTCCTCCGGCAAAACAGACGCTGCCCTGCAGCTCGCACAAGAGCTCGCAGAGAACTACCCC
GAAAACAACACGGTGCAGGTTCTTGCTGCTACTGTGCTCCAGGCCCAGGGACACAGCGAGGAGGCGCTGGCGCTG
CTGTCCAAGCACCAGGGTAACCTCGAGGCCGTCTCCCTCATTGTCCAGATCCATCTCGTACAAAACCGGACCGAT
CTCGCGCTCAAGGAGGTTCAGGCTGCCAAGCGCTGGGGTCAGGATTCGCTGCTGGTCAACGTTGCCGAGTCGTGG
GTTGGCTTGAGAGTTGGCGGCGACAAGTACCAGTCTGCTTTCTACGTCTTCGAGGAGCTCGCATCCGCACCCGGT
ACCTCCGCACCGCTATCTATCGTTGGTCAGGCCATCGCTGAGATCCACCTGGGTCGTCTTCCTGAGGCTGAGGCT
GCCCTCACCGCTGCCCTTGAGACATACCCTACCGACGTGGAGTTGATTGCCAATAGCATTGTTTTGAATGTGTTG
GCTGGCAAGCAGACCGAGGACCTGGAGTCCCGGCTACAGCAGGTCCAGCCCGCGCACCCCCTTCTCACCGATATC
CAGGAGAAGAGCGAGTTTTTCGATACTGCGGCGGCAAAGTTCTCTGCTAAGGTCTCATCGTAG
Gene >Pro_DTO377G3_2|g2044.t1
ATGGATCCCTTTTCTGCAGAGGGCGGTACGCATTCCAGTTCTTTCTACAGCTCCGATCAACGCTAACCCAGCTTC
CCCGCAGAGCTCCTCAACATCCACAGCGCCTTCCACTCAGGCCAATACCAGAATGTGATTGACTTCGAGACCGCC
GCGCTCTCCCCCGAGAACCAGCTCCCCGCTCAAGTCCTCCGACTCCGCGCCCAGATTGCCCTTGGCCAATTCGAA
GAAAGCCTCGCCGAGCCCTCCATCGAAGAGGACAGCCCTGACCTCTCCGCCGTCAGGGCCCTGGCACTGCAGTCC
TCCGGCAAAACAGACGCTGCCCTGCAGCTCGCACAAGAGCTCGCAGAGAACTACCCCGAAAACAACACGGTGCAG
GTTCTTGCTGCTACTGTGCTCCAGGCCCAGGGACACAGCGAGGAGGCGCTGGCGCTGCTGTCCAAGCACCAGGGT
AACCTCGAGGCGTGAGTTACCCCGTCGCAAGTAGGCCGCAAATATAACGGAGCATGTTGGTCTGACATTCTATCT
CTCCTAGCGTCTCCCTCATTGTCCAGATCCATCTCGTACAAAACCGGACCGATCTCGCGCTCAAGGAGGTTCAGG
CTGCCAAGCGCTGGGGTCAGGATTCGCTGCTGGTCAACGTTGCCGAGTCGTGGGTTGGCTTGAGAGTTGTATGTT
GATGATAAACCCATAATCTTCTGGTTGATGGTTGATGGTCTATGAGTGCTGATTTGTGTTTCTGTACAGGGCGGC
GACAAGTACCAGTCTGCTTTCTACGTCTTCGAGGAGCTCGCATCCGCACCCGGTACCTCCGCACCGCTATCTATC
GTTGGTCAGGCCATCGCTGAGATCCACCTGGGTCGTCTTCCTGAGGCTGAGGCTGCCCTCACCGCTGCCCTTGAG
ACATACCCTACCGACGTGGAGTTGATTGCCAATAGCATTGTTTTGAATGTGTTGGCTGGCAAGCAGACCGAGGAC
CTGGAGTCGTATGTCATCCTATCGGAGAAGAAGATAGTGAACTCGATGCTAACTTTTATCTTGTCTAGCCGGCTA
CAGCAGGTCCAGCCCGCGCACCCCCTTCTCACCGATATCCAGGAGAAGAGCGAGTTTTTCGATACTGCGGCGGCA
AAGTTCTCTGCTAAGGTCTCATCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail