Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2032.t1
Gene name
Locationscaffold_02:1482123..1494685
Strand-
Gene length (bp)12562
Transcript length (bp)12207
Coding sequence length (bp)12207
Protein length (aa) 4069

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 8.1E-75 3072 3480
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 2.1E-73 9 259
PF00668 Condensation Condensation domain 3.8E-67 2608 3038
PF08659 KR KR domain 4.1E-51 2107 2281
PF14765 PS-DH Polyketide synthase dehydratase 1.8E-48 940 1240
PF00698 Acyl_transf_1 Acyl transferase domain 2.5E-38 550 870
PF07993 NAD_binding_4 Male sterility protein 6.5E-36 3732 3956
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 3.2E-28 269 388
PF08242 Methyltransf_12 Methyltransferase domain 2.1E-18 1418 1519
PF01370 Epimerase NAD dependent epimerase/dehydratase family 9.2E-14 3730 3951
PF00550 PP-binding Phosphopantetheine attachment site 1.1E-09 3608 3673
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 1.5E-14 393 490
PF13649 Methyltransf_25 Methyltransferase domain 2.3E-14 1417 1517
PF13489 Methyltransf_23 Methyltransferase domain 1.1E-14 1413 1573
PF13847 Methyltransf_31 Methyltransferase domain 3.0E-13 1414 1528
PF08241 Methyltransf_11 Methyltransferase domain 8.9E-14 1418 1521
PF00106 adh_short short chain dehydrogenase 4.8E-12 2110 2280
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 6.3E-08 3731 3917
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 4.7E-09 1406 1532

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0008168 methyltransferase activity Yes
GO:0008152 metabolic process No
GO:0008202 steroid metabolic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008150 biological_process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016740 transferase activity No
GO:0006629 lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0003674 molecular_function No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0016491 oxidoreductase activity No
GO:1901576 organic substance biosynthetic process No
GO:0016229 steroid dehydrogenase activity No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 11.92 7.32 16.51
5d_25C Five days - 25 degrees Celsius 20.03 11.97 28.09
7d_25C Seven days - 25 degrees Celsius 22.82 13.56 32.08
10d_25C Ten days - 25 degrees Celsius 32.49 18.73 46.24
7d_15C Seven days - 15 degrees Celsius 15.76 9.53 21.99
7d_30C Seven days - 30 degrees Celsius 22.64 13.61 31.67

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.010083 yes
3d_25C 7d_25C 0.001278 yes
3d_25C 7d_15C 0.224343 no
3d_25C 7d_30C 0.001804 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.640697 no
5d_25C 7d_15C 0.327396 no
5d_25C 7d_30C 0.663439 no
5d_25C 10d_25C 0.024892 yes
7d_25C 7d_15C 0.095723 no
7d_25C 7d_30C 0.981156 no
7d_25C 10d_25C 0.124534 no
7d_15C 7d_30C 0.100169 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.109209 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2032.t1
MPPLCSLPEPIAIVGSGCRFPGQSNSPSKLWELLREPKDLQTEIPPNRFNPDGFYHPDNLHHGTSNVRHSYLLEE
DYRVFDAQFFGIKPAEANCIDPQHRLLLETVYESVDSAGLRLEDLRGSETAVYVGLMWGDYADMIGRDPESFPMY
TSTGTARSIISNRISYFFDWHGPSMTIDTACSSSLVAVHEAVQTLRAGRSRVAVAAGSNLCLVPEPYIAESKLQM
LSPTGRSRMWDAKADGYARGEGVAVVVLKTLSAALEDGDHIECLIKETGVNQDGRTNGITMPSSTAQTALIRATY
ANVGLDPQKKEDRCQFFEAHGTGTPTGDPLEAAAISNAFFPARGEENDRLYVGSIKTVVGHTEGTAGLAGVLKAS
LALQNRTIPPNLLFNQLNPKIEPFYTNLEITTTAKPWPVLPSGVPRRASVNSFGFGGTNAHAILEAYERPVVPRD
RDQVNFTPFILSATSEASLTRNLTSFAEYLQENPAVNIRDVSWTLYSRRSRLAFSTIVAGATTERLLANIQARLE
ETDAKAPLAVRHHQSQTENPRVLGVFTGQGAQWATMGRELLKSAKVREIVQGLDLALQRLPSNDRPRWTLLKEFM
TDALASRIKEAEISQPMCTAVQIILVQLLRGAGVTLDSVVGHSSGEIAAAYAAGFFSADDAICIAYYRGLCSRSA
RGPDGQKGAMMAVGTSLEDALELCKEPEFHGRISVAAVNSSASVTLSGDAEAIEQAKAVFDEEKKFVRILAVDKA
YHSHHMRACSDQYISSLKNLNIKIGHPPPSAPVWYSSVREGNITVAGALDLADTYWSDNMVHPVLFAQAVESATA
GHGPFTLAIEVGPHPALRGPTLQIIQDLLDASLDYTGTLQRGSHDLEAMSGCLGYLWQTLPPSSVDLCRYDALLS
DGSQPQIVKDMPSYAWDHDRIFWYESRLWKATRSRSTPVHPLLGSRCPDGVEQEFRWRNFLSPREVPWLSGHQIQ
GQMVFPGAGYVSSAVEAAKNMAPNETIRLVELEDLVIRQAMIFDNESSSVETLVSITNIIHKQKDTVLANFAFYS
AVGQESTAMTMNASGRLIITYGTPTPDALPVRRPSLVDMIDVPSERFYNSLDPIGYSYTGPFRALTDMKRKLGIA
TGFVNREPTPDSASLTLHPAMLDASIQAVLLAKSFPGDGQLWCLQVPKVIRRVAVNPSLCVSYDPIVQTAFQLDA
VLTQMEASDTLGDVDIYSPDGQHTLARMEGIHAVPLEAASAASDRPFFSSMVWSPSSPDTESVTFAGKATNEDYE
LAYVLERVSIFYLRQLHLKFPATHQARHEGPYLGLLRFASHVSGLVENDRHRYAQRSWIHDTHAVIMRESQRFPD
NVDLAVMQIIGEHMAKVIEGQSTILEYLTKDNLLSRYYEEAMGIGYFSDYLAGVVAQIVHRYPHMRILEIGAGTG
SATKKVISTVGRSFSSYTFTDISNGFFENARELFSSHSGQMLFKVLDAEKDITSQGFHEESYDVIVASFVLHATS
RLEHTLNNIRRLLKPGGYLVMLEVTNLEQSRLGYIFGSFPGWWLGADDGRVLSPCVTTDEWDRLLRKTGFSGIDS
ITPDADALPFPASAIVSQAIDPTVQFLRDPLESSGEFLDSKTDILVVGGASDAVHNVRKEILYHLKSRFDHVSVI
DCLQDLSKAPTSSGYFTLNLSDLDEPVFKNMTAEALAGLKLIYERSAYLLWVTEDSRAGNIHQNQSLGFGRSMTV
EMPHVQSQFLDLDSVSSSGAALIIARAILRFIGVNISDNPERANRLLWSTEQELAVIRDKEFIPRILLNNAQNLR
YNASRRAIAEEVDLRSKIVTVKGNAGAYVVEHGSEYDSPATPPGSKRISVEASSLKAVRLLSGNDLYLVAGTVVA
TGEKVFGFAARNSSVVDIPSSWTIPSDDSPTKLLPFAAAHAVARSIVSSAHSHTALIVIEPEKVVSSALAFHASQ
RGLRIIFLTSDGNHMQPSWIVVHPHTHVRSLQQLLPNEPVMVLDMRPGAEGSSLTLKLRSALHSSSTFERLANFC
SDTVRSSEEHIPTETIQMIATERHHDAATMRQAEQVFIPLQDISSLSLNQSAFSFIDWTSTSTVSSLIRRVDHYP
FLRNDRTYWLVGLTGSLGLSLCQWLIWQGAMNVVLTSRNPNIDPTILQELRTSGARVEVYAGDVTDRESLRSVYD
RICRNLPPIAGVAQGAMVLQDTMVKDMDIEAMQKVLKPKVTGSIHLDELFSHIHPLDFMIFFSSATCVTGNIGQS
NYAAANMFMTALAANRKQRGLAGSVINIGAIMGVGYVTRETSEALQRNLLKSGHVWMSEGDFHTIFAEAILAGSP
SSNATVELTCGLRIIRDVDEQRPLWSYSPKFQHLVVLDELSTETDGDSKRQMPLRLQLLEARTADEISKIVQESF
FAKLQIMLGLHDVASSSILDKAADELGIDSLNTVEIRSWFLKELKVDIPVLRILGGATIDDILHFALDRLPTEMT
PNIGAAPVPRVGEAVVRQQSEIQSRTSERKLGSIPKLASSADPVARPRPGGPGRTVSSKSLSNGQSSSTRASTTS
SLVDISRGEDTSSGSFSIIETPSFSEDEHNLPLPDNPSQANLLKQPGDSVHSALRKEPLSFAQSRFWFLRLYLED
QTTFNITCSLRIQGAFSVDALERAVQGVGQRHEALRTCFSAEDGESPTQIILPHSTLSLERKTYHTMSEVEATMR
EVKNHIYDLEHGQLMRVLLLCPAVLATPLVHFLIIGYHHINMDGVSLEVILSELQNTYEGRSLSTRVLQYPDYAA
KQRQQRNNGSWNEDLAFWRERFPEPPADFPLLPFACVSDRQALLRYGHHRVQQRLNPSLGRQIRQFCQSVKCTPS
HFYLAAFQALLCRLAETQDICIGMADANRIQVEAADSVGPYLNLLALPLHYDANTPFVELTRSARKKVYSSLAHS
QVPFDILLSELKVPRSPSHNPLFQVFMDYRQDVREKRQFGECLFEGLDYEMGRTSYDVALDIVDKVEGEPLVILG
LQQSLYSTEAAETLLNAFLNMVAVFANDPSTPVGQASIFAVKDVQRSLALSQGPTVPSRWPATLPHRIDTMVQRF
PKKLALKDGLNNRFTFEEMSQRIDSIAFALLGANVSRGQRVGVFQHPTADWICSMLAILRVGATYVPLDLRLEIP
RLKSICDDCKPMVLLVDNETKDQVDELGCSNALSMNIYDLPMSFPIPVVNRAVLEDPAVIFYTSGSTGAPKGIAL
THENLRVNVEGNQEEFRLWPHDHLLQQIAFSFDFSVWQVFMALANAASLFIAPLSKRGDPVALVESILTEGITVA
GATPSEYHSWFMHGDLSGLKKSKWRTAVSAGEPMTSSMIHDFQELNKRDLRLFNGYGPTEASMSSNKLQVPYLRS
KTQSPQEWMHRGSVVAGYTAPNYSIYIVDEALNPVPVGIPGQILIGGPGIAHGYLNNEDLSRSRFMEDRFATAEQ
KAQGWRRVHLTGDRGRIRPDGQLQIEGRINGDTQVKLRGYRVDLRDIETVILQSSQGMLKEAVVTLYTGSNTNTE
LLVAYVIFLAGYPVEQRKQSLRELSKSLPLPRYMWPSMVLPVDDMPVTAHGKLDRKALSTRSLPQTEAESVGLTS
QLTGTEARLVELWRSVISKDVIAIHGLEPESDFFAVGGNSMLLVELQRQIKVEFRTEIPLVQLFGATTVQKMALL
LDPSTDAAKIAAGPVATTAAAPIIWEQEIQLPDQLQLSTPMAPTTRLENLKGLCIVLTGATGFIGRALLQRLVED
PAVATVHCIAVRVTSTRRPPLVTAGKIIVHYGDLTLPRLGLVEAQATAIFNDADAVIHNGADVSFLKNYPALRRA
NVDSTIELLQLAWPRQVPVHYVSTSGVANFTQSSTFAEVSAASVLPPTDGSQGYLSSKWASERVLEEANRKADFP
VWIHRPSSVTGEGSSPLDLMDNLLEFSRKLRAVPLPAKSSWQGYLDFVPVEQVARDIVREILAPRDPSPLNQVRY
LHHLGEQIPLHGIQRYLEKGTGASYRALPMGEWLKEAQQAGLSALLVEYLGQMDRPDVKVVFPRLVARPRLTSGG
LTRQGSWVSKGVAMLLTW*
Coding >Pro_DTO377G3_2|g2032.t1
ATGCCACCACTGTGCAGCCTTCCTGAGCCGATAGCCATCGTTGGCAGTGGCTGCAGATTCCCTGGGCAGAGCAAT
TCGCCGTCAAAGCTCTGGGAGCTGCTACGGGAGCCAAAAGACCTACAGACCGAAATTCCACCCAACCGTTTCAAT
CCTGATGGCTTCTACCACCCAGACAATCTTCATCATGGCACCAGCAATGTTCGCCATTCCTACCTACTGGAGGAG
GACTACCGTGTTTTTGACGCGCAATTTTTTGGAATCAAGCCTGCCGAAGCCAATTGTATTGACCCTCAGCATCGC
CTACTCCTCGAGACAGTCTATGAATCGGTTGACTCCGCTGGTTTGCGGCTGGAGGACCTCCGGGGTTCAGAAACA
GCAGTCTATGTCGGGTTGATGTGGGGGGACTATGCCGATATGATCGGCCGGGATCCTGAATCCTTCCCCATGTAC
ACTTCCACCGGAACCGCTCGAAGCATCATCTCGAACCGGATCTCTTATTTCTTTGACTGGCATGGGCCGTCTATG
ACGATTGACACGGCATGTTCGTCTAGTCTGGTAGCGGTCCATGAAGCTGTGCAAACACTTCGTGCCGGCCGCTCT
AGGGTTGCTGTAGCTGCTGGGTCAAACCTCTGTCTAGTGCCAGAGCCGTATATTGCGGAGAGTAAACTTCAAATG
CTTTCCCCAACCGGAAGAAGTCGTATGTGGGATGCCAAGGCGGATGGATATGCTCGTGGAGAAGGTGTCGCCGTT
GTAGTGCTCAAAACCTTGAGTGCTGCTTTGGAAGATGGCGATCACATTGAGTGTCTTATTAAGGAGACGGGCGTG
AACCAAGATGGTCGCACCAATGGCATTACTATGCCCAGCTCTACGGCACAGACAGCATTGATCCGTGCCACTTAC
GCCAACGTGGGACTAGATCCCCAAAAGAAAGAAGACCGCTGCCAATTCTTTGAAGCGCATGGAACGGGGACACCG
ACGGGCGACCCCCTGGAGGCAGCCGCCATTAGCAATGCTTTTTTTCCTGCAAGAGGAGAAGAAAATGATCGACTC
TACGTCGGTTCTATCAAGACAGTGGTCGGCCACACAGAAGGAACGGCAGGTCTAGCCGGTGTGTTGAAGGCATCA
TTAGCTCTTCAAAATCGCACTATTCCCCCGAATCTTCTTTTCAATCAACTCAACCCCAAGATCGAACCCTTTTAC
ACCAACCTGGAGATAACTACAACGGCGAAGCCCTGGCCAGTACTGCCGTCGGGTGTACCGCGCCGGGCGAGTGTA
AACAGTTTCGGCTTTGGAGGAACCAATGCGCATGCAATCTTGGAGGCATATGAGCGTCCTGTCGTCCCGCGGGAT
CGAGATCAGGTCAACTTCACGCCATTCATCCTCTCTGCCACTTCTGAGGCCTCTCTCACCCGAAATTTGACATCG
TTCGCGGAATATCTCCAGGAAAACCCCGCGGTGAATATCCGAGATGTTTCCTGGACGCTGTACTCGCGCAGATCT
CGTCTCGCTTTCTCCACGATTGTCGCTGGTGCAACGACAGAACGCCTACTGGCCAACATTCAAGCCCGCCTTGAG
GAAACAGACGCTAAAGCCCCCCTCGCTGTGAGACACCACCAGTCTCAAACGGAGAACCCTCGAGTACTCGGAGTC
TTCACAGGCCAAGGTGCCCAGTGGGCCACGATGGGACGCGAGTTACTGAAGTCGGCCAAGGTCCGAGAGATTGTG
CAGGGCTTGGATCTTGCTCTCCAACGTCTTCCAAGCAACGACCGCCCGAGATGGACTTTGTTGAAGGAGTTTATG
ACCGATGCGTTGGCGTCGCGCATCAAGGAGGCCGAGATCTCCCAGCCAATGTGCACGGCGGTGCAAATTATCCTA
GTGCAGCTGCTGCGTGGTGCTGGTGTCACCTTGGATTCGGTAGTTGGCCACTCCTCCGGGGAGATTGCTGCGGCC
TATGCAGCCGGGTTTTTCTCCGCAGACGATGCCATCTGTATAGCCTACTATCGTGGGTTGTGCTCTCGGTCGGCT
CGAGGCCCCGATGGACAGAAAGGAGCCATGATGGCCGTCGGAACCTCCCTTGAAGATGCTCTTGAGCTCTGCAAG
GAGCCTGAGTTCCACGGACGGATTTCGGTGGCCGCAGTCAATTCCTCGGCCAGTGTCACACTGTCCGGTGATGCC
GAAGCAATTGAGCAAGCCAAAGCCGTTTTTGATGAAGAGAAAAAGTTCGTTCGCATATTGGCCGTGGACAAGGCC
TATCACTCCCACCACATGAGAGCCTGCTCCGATCAATATATTTCCTCCTTGAAAAACTTGAATATCAAAATCGGC
CATCCGCCACCCTCAGCCCCCGTCTGGTACTCCAGCGTGCGGGAAGGGAACATAACAGTCGCAGGAGCGCTCGAT
CTTGCAGACACATACTGGAGCGATAACATGGTCCACCCAGTCCTCTTTGCTCAAGCGGTTGAAAGCGCCACCGCT
GGCCATGGCCCGTTTACTTTAGCAATTGAAGTGGGACCTCATCCTGCCCTGCGTGGCCCAACTTTGCAGATAATA
CAAGACTTGCTTGACGCGTCCTTGGACTACACAGGGACGTTGCAGCGAGGCTCCCATGATCTCGAAGCGATGAGT
GGTTGCCTAGGATACCTATGGCAGACGCTGCCGCCGTCCAGTGTGGATCTGTGTAGGTACGATGCGCTACTATCG
GATGGGTCTCAACCGCAAATTGTCAAAGACATGCCTTCGTACGCTTGGGACCATGATCGCATATTCTGGTACGAA
TCGCGGCTATGGAAGGCGACCAGGAGTAGATCGACTCCAGTCCATCCCCTCCTGGGCTCTCGGTGCCCGGATGGA
GTGGAGCAAGAATTCCGCTGGCGGAATTTCTTGAGCCCCCGTGAGGTCCCTTGGCTCTCAGGCCATCAGATTCAG
GGACAGATGGTTTTCCCTGGGGCTGGCTATGTATCTTCGGCGGTGGAAGCAGCGAAGAATATGGCGCCCAACGAG
ACTATTCGGCTGGTCGAGTTGGAGGACCTAGTCATCCGCCAGGCGATGATCTTCGACAATGAAAGTTCATCCGTG
GAGACGCTTGTTTCTATCACAAATATCATCCACAAACAGAAGGACACGGTGCTGGCCAACTTCGCCTTCTACTCT
GCCGTCGGGCAGGAGTCGACCGCCATGACCATGAACGCTTCAGGACGTCTCATAATCACCTACGGCACCCCCACT
CCAGATGCGCTACCGGTGCGGCGACCATCCCTTGTCGATATGATTGATGTTCCTAGTGAAAGGTTTTACAACTCG
CTGGACCCTATCGGATACAGCTATACGGGCCCATTCCGAGCGCTAACCGACATGAAGAGGAAACTGGGTATCGCG
ACAGGTTTTGTCAACCGAGAACCTACCCCCGATTCAGCCTCTCTGACCTTGCACCCGGCCATGCTAGATGCGTCC
ATTCAGGCCGTTTTGCTTGCCAAAAGCTTCCCCGGTGATGGGCAATTGTGGTGTCTTCAAGTTCCCAAGGTGATC
CGGCGGGTGGCTGTGAATCCAAGCTTGTGTGTCTCATATGACCCAATTGTGCAGACTGCTTTCCAGCTTGATGCT
GTGTTAACTCAAATGGAGGCTTCTGACACCTTGGGTGATGTTGATATCTACTCTCCGGATGGTCAGCACACGCTT
GCCCGCATGGAAGGCATACATGCTGTGCCTCTTGAAGCTGCTAGCGCTGCCAGTGATCGGCCATTTTTCAGCTCA
ATGGTCTGGAGCCCTTCATCGCCAGATACAGAGTCGGTGACCTTTGCTGGGAAAGCCACCAACGAGGACTATGAG
CTCGCCTATGTCCTGGAAAGAGTGTCAATATTCTATCTCCGCCAACTCCATCTTAAATTTCCCGCCACTCACCAA
GCTCGTCACGAGGGTCCCTACCTCGGCCTGCTTCGATTTGCATCCCATGTTTCTGGCTTGGTTGAGAATGATCGG
CACCGTTACGCTCAACGGAGCTGGATCCATGATACTCACGCCGTAATTATGCGTGAAAGCCAAAGGTTCCCCGAC
AATGTCGATCTTGCTGTGATGCAGATCATTGGGGAACACATGGCGAAAGTCATCGAGGGTCAATCCACCATCCTG
GAGTATCTCACAAAGGACAACCTCCTGAGTAGATACTATGAAGAAGCCATGGGAATTGGCTACTTCAGTGATTAC
CTTGCTGGTGTAGTAGCTCAGATTGTGCATCGTTATCCCCACATGAGAATCCTTGAAATCGGTGCTGGTACCGGT
AGTGCGACGAAGAAAGTCATCAGCACCGTTGGTCGTAGCTTTTCTAGCTATACATTCACTGATATATCCAACGGG
TTCTTTGAGAATGCCAGGGAACTGTTCTCTAGCCATTCCGGCCAGATGCTCTTCAAAGTCCTCGACGCAGAGAAG
GATATTACTTCTCAAGGGTTCCATGAAGAATCCTACGACGTCATTGTTGCATCCTTTGTCCTGCATGCGACTTCG
AGATTGGAACACACCCTGAATAACATCCGACGCCTGCTGAAACCCGGGGGGTATTTGGTCATGCTAGAGGTCACC
AACCTGGAGCAGTCACGTCTAGGATATATATTTGGATCGTTTCCCGGCTGGTGGCTCGGTGCTGACGATGGCCGG
GTACTCTCCCCTTGCGTGACCACGGACGAATGGGATCGGTTACTGCGCAAGACTGGTTTTTCTGGGATTGATAGT
ATTACACCAGATGCGGATGCACTTCCATTCCCGGCGTCTGCCATCGTCTCCCAAGCGATCGATCCCACTGTCCAG
TTCCTCCGCGATCCCCTGGAATCTAGCGGTGAGTTCCTAGATTCCAAAACGGATATTCTAGTCGTTGGCGGCGCC
TCAGATGCAGTGCATAACGTGCGCAAGGAAATTCTTTATCATCTTAAATCCCGTTTCGATCATGTATCGGTTATA
GACTGTCTGCAAGATCTCAGCAAAGCACCCACTTCCTCCGGATACTTTACGCTGAATCTTTCGGATCTAGACGAG
CCTGTCTTCAAGAACATGACCGCAGAGGCGTTGGCTGGTCTGAAGCTCATCTACGAACGATCAGCTTATCTTCTT
TGGGTGACTGAGGATTCTCGCGCTGGGAATATTCACCAAAATCAGAGCCTTGGCTTTGGTCGCTCAATGACCGTT
GAAATGCCCCATGTTCAATCCCAATTCCTAGATTTGGACTCGGTGAGTTCGTCTGGAGCTGCCCTAATTATTGCA
CGAGCTATCCTGCGCTTTATCGGTGTGAACATATCAGACAATCCCGAGCGAGCAAATAGGCTGCTCTGGAGCACC
GAGCAAGAATTGGCTGTGATCCGAGATAAGGAGTTCATTCCACGTATCCTACTCAATAATGCCCAAAATCTGCGG
TACAATGCATCGAGGCGAGCAATTGCGGAAGAGGTCGACCTCCGCTCCAAGATTGTGACGGTAAAGGGGAATGCG
GGGGCTTATGTCGTTGAACATGGCTCTGAGTATGACTCTCCCGCTACTCCCCCAGGCTCGAAAAGAATTAGTGTC
GAGGCATCTTCTCTAAAGGCGGTCCGTCTACTTAGCGGTAATGATCTATATTTGGTCGCCGGCACAGTTGTTGCA
ACGGGTGAGAAAGTCTTTGGTTTTGCTGCAAGGAACTCTTCAGTGGTCGACATTCCCAGCAGCTGGACCATTCCT
AGCGACGACTCCCCCACGAAGTTGCTACCGTTCGCGGCCGCCCATGCTGTTGCGCGCTCCATTGTATCGTCTGCC
CACAGCCATACAGCACTGATCGTGATTGAGCCTGAGAAGGTCGTTTCATCGGCACTAGCATTCCATGCCTCTCAG
AGAGGCTTACGCATTATCTTCTTGACCTCAGATGGGAATCACATGCAGCCATCCTGGATTGTTGTGCATCCGCAC
ACTCACGTACGATCATTGCAACAGTTACTGCCCAACGAGCCGGTGATGGTCCTGGACATGCGACCCGGCGCTGAG
GGCAGCAGCCTGACGTTGAAGCTTCGCTCGGCATTGCACTCGTCGTCTACCTTTGAGCGGCTCGCTAATTTCTGC
AGCGATACCGTGCGAAGTTCAGAGGAGCACATCCCTACTGAGACTATACAGATGATAGCCACGGAGAGACACCAT
GATGCCGCTACCATGAGACAAGCAGAGCAGGTCTTCATCCCACTCCAGGATATCAGTAGCCTATCTCTGAACCAA
TCTGCATTCTCCTTCATCGACTGGACATCCACTTCAACGGTTTCTTCCCTGATTCGCAGGGTTGACCATTATCCC
TTTTTGCGCAATGACAGGACATACTGGCTTGTCGGTCTGACGGGATCCCTGGGTTTGTCCCTTTGTCAATGGTTG
ATTTGGCAAGGCGCCATGAACGTGGTACTGACTAGCCGAAACCCCAACATCGATCCTACAATTCTCCAGGAGCTC
AGAACCTCTGGAGCTAGAGTTGAAGTATATGCCGGCGACGTGACGGACCGAGAGAGTCTGCGGTCAGTATATGAC
CGCATCTGTCGGAATCTTCCCCCAATTGCTGGAGTGGCTCAGGGAGCGATGGTGCTGCAAGACACCATGGTTAAG
GACATGGACATCGAAGCTATGCAAAAGGTGTTGAAACCGAAGGTGACCGGCAGCATTCATCTGGATGAGTTGTTC
TCCCACATCCATCCTCTAGACTTCATGATTTTCTTCTCCTCTGCAACTTGCGTCACAGGTAATATCGGCCAGTCC
AACTACGCCGCTGCCAATATGTTCATGACCGCACTAGCAGCGAACCGCAAACAGCGCGGGCTAGCAGGTTCTGTC
ATAAATATTGGAGCGATCATGGGAGTCGGCTATGTCACTCGTGAAACGAGCGAGGCGCTGCAAAGAAATCTTCTG
AAGAGTGGTCATGTGTGGATGTCAGAAGGCGACTTCCATACAATATTCGCAGAGGCTATCCTCGCTGGGTCTCCT
AGTTCCAACGCCACGGTGGAGCTCACATGTGGGCTGCGTATTATCAGAGATGTTGATGAGCAGCGTCCGTTATGG
TCATACAGCCCGAAATTCCAGCATCTAGTCGTTCTCGACGAGTTGTCCACAGAAACCGATGGCGACTCCAAGAGG
CAGATGCCGCTTCGACTACAGCTTCTTGAGGCAAGAACAGCTGATGAGATCTCCAAGATTGTTCAAGAATCTTTC
TTTGCTAAGCTCCAGATTATGCTGGGTTTGCATGATGTGGCCAGCAGTTCTATCCTCGATAAAGCTGCAGATGAG
CTTGGAATCGATTCATTGAACACTGTCGAAATCAGATCCTGGTTCTTGAAGGAACTGAAAGTTGACATCCCGGTA
CTACGCATTTTGGGAGGTGCCACCATTGACGACATTCTCCACTTCGCCTTAGATAGGCTTCCTACCGAGATGACC
CCAAACATTGGAGCTGCTCCTGTGCCGCGGGTTGGTGAGGCTGTTGTTAGACAGCAATCTGAGATTCAATCCCGG
ACTTCGGAACGGAAGCTTGGCAGTATTCCCAAGTTGGCTAGTTCTGCGGACCCTGTTGCTCGGCCAAGACCCGGT
GGACCTGGACGGACTGTCTCCTCAAAGTCTCTTTCGAATGGCCAAAGTTCATCTACGCGGGCAAGCACCACCTCC
AGTCTCGTTGATATATCCCGAGGCGAGGACACTTCATCCGGGTCCTTCAGCATCATCGAAACGCCTTCATTCAGT
GAAGATGAGCATAATTTGCCGCTTCCGGATAACCCGAGCCAGGCCAATCTCCTGAAGCAGCCGGGCGACAGTGTC
CACTCGGCGTTACGGAAGGAGCCACTCTCCTTTGCACAATCTCGTTTCTGGTTCCTCCGCTTATACCTTGAGGAT
CAGACTACCTTTAATATCACTTGTTCATTACGAATCCAGGGCGCCTTTTCAGTTGATGCCCTTGAGCGAGCAGTT
CAAGGGGTGGGCCAACGACATGAAGCCCTAAGAACATGCTTTTCTGCGGAGGATGGAGAATCACCTACGCAAATC
ATCCTGCCACACTCAACGTTGTCTCTGGAAAGGAAGACTTATCACACAATGTCTGAAGTTGAGGCTACTATGCGA
GAGGTTAAGAATCACATCTACGACCTTGAGCATGGACAGCTAATGAGGGTGCTTCTGTTGTGCCCTGCGGTGTTG
GCAACACCCCTGGTGCACTTCCTGATAATTGGATACCACCATATCAACATGGATGGTGTTAGCCTGGAGGTGATT
CTCTCTGAACTGCAAAACACCTACGAAGGACGTTCTCTCAGTACGCGAGTACTTCAGTACCCCGATTACGCGGCC
AAACAACGTCAGCAGCGAAATAACGGCTCGTGGAATGAAGACTTGGCCTTCTGGAGAGAGAGATTTCCCGAACCC
CCAGCGGACTTTCCATTACTGCCTTTCGCGTGTGTATCTGACCGCCAAGCTCTGTTACGATATGGTCATCACCGA
GTGCAACAACGCCTGAACCCAAGTCTAGGAAGACAAATCCGCCAGTTTTGCCAATCTGTCAAATGCACGCCTTCG
CATTTCTATCTTGCAGCATTCCAGGCACTGCTCTGTCGACTCGCTGAGACCCAGGATATCTGCATCGGCATGGCT
GATGCCAACCGTATTCAGGTAGAAGCAGCTGACAGCGTGGGGCCATACTTGAATCTGCTCGCCCTACCTTTGCAC
TATGATGCCAACACGCCTTTCGTTGAGTTAACTCGATCAGCTCGTAAGAAGGTCTACAGTTCTTTAGCTCACTCA
CAGGTGCCATTCGATATTCTGCTATCCGAACTCAAGGTTCCGAGATCGCCATCCCATAACCCGTTGTTCCAAGTT
TTCATGGATTATCGGCAGGATGTCCGCGAGAAACGGCAGTTCGGAGAATGTCTATTCGAAGGTCTAGATTATGAA
ATGGGTCGAACATCCTACGATGTTGCTTTGGATATTGTCGACAAAGTGGAAGGCGAGCCATTGGTCATTCTTGGC
CTCCAGCAATCCCTATACAGTACCGAAGCAGCTGAGACTCTTCTGAACGCCTTTCTAAACATGGTCGCAGTCTTT
GCCAATGATCCATCTACCCCCGTGGGCCAGGCGTCTATATTCGCTGTAAAGGATGTTCAAAGGTCCCTTGCACTC
AGCCAAGGCCCGACAGTGCCCAGCCGATGGCCAGCAACGCTCCCCCATCGTATTGACACGATGGTGCAACGGTTC
CCCAAGAAACTTGCTTTGAAAGACGGCCTCAACAACCGATTCACTTTTGAGGAAATGAGTCAACGAATCGACTCA
ATTGCGTTCGCTCTGTTAGGCGCCAACGTCAGCCGTGGCCAACGTGTGGGTGTGTTTCAGCATCCAACGGCCGAC
TGGATCTGTTCTATGCTGGCCATTCTGCGAGTGGGAGCTACTTATGTTCCGCTCGATCTTCGGCTCGAAATTCCA
CGTCTCAAATCGATCTGTGATGACTGTAAGCCTATGGTCCTTCTCGTGGACAATGAGACGAAAGATCAAGTGGAC
GAATTGGGGTGTTCGAACGCACTGTCAATGAACATCTACGATTTACCAATGTCCTTCCCTATCCCTGTCGTCAAT
CGTGCCGTCTTGGAAGATCCAGCCGTGATATTTTATACTAGCGGTTCGACTGGTGCTCCCAAAGGCATTGCATTG
ACCCACGAGAACCTGCGCGTCAACGTCGAAGGAAACCAGGAGGAGTTCCGACTCTGGCCGCACGATCACCTGCTG
CAGCAAATTGCTTTCAGCTTTGACTTTTCGGTATGGCAGGTGTTCATGGCGTTGGCAAACGCCGCTTCGCTTTTC
ATTGCCCCGCTGTCTAAACGTGGTGATCCGGTGGCCTTGGTGGAATCGATTCTTACGGAGGGTATCACCGTCGCA
GGGGCCACTCCTTCCGAATATCACAGTTGGTTTATGCACGGTGATTTGTCGGGTCTCAAGAAGTCCAAATGGAGG
ACTGCGGTCAGTGCAGGGGAGCCGATGACTTCGAGCATGATTCATGATTTCCAAGAGTTGAACAAGCGGGATCTT
CGACTTTTCAACGGGTACGGCCCAACCGAAGCCAGCATGTCTTCCAACAAACTGCAAGTGCCGTACCTCCGCAGC
AAAACCCAGAGTCCACAGGAGTGGATGCACCGTGGGTCGGTCGTCGCCGGATACACGGCCCCGAATTACTCCATC
TACATAGTCGACGAAGCGCTCAACCCCGTTCCCGTTGGTATTCCAGGCCAGATACTTATTGGTGGTCCTGGGATC
GCGCATGGGTACTTGAACAACGAGGATCTATCACGCAGTCGCTTCATGGAGGACCGATTCGCCACGGCCGAACAA
AAGGCTCAAGGATGGCGACGGGTTCACCTCACCGGCGATCGCGGGCGAATCCGGCCAGACGGACAACTTCAAATC
GAGGGTCGGATTAACGGGGACACCCAGGTGAAGTTGCGCGGCTACCGCGTCGACTTGCGCGATATCGAAACGGTG
ATCCTTCAATCATCGCAAGGGATGCTTAAGGAGGCCGTCGTCACTCTCTATACAGGCTCCAATACCAACACGGAA
CTGCTGGTCGCTTATGTGATTTTCCTTGCCGGATATCCTGTGGAGCAACGCAAGCAATCCTTGCGGGAACTTAGC
AAATCTCTGCCTCTGCCTCGTTACATGTGGCCGTCCATGGTGCTCCCCGTGGATGACATGCCAGTCACAGCCCAC
GGCAAGCTTGACCGCAAGGCCTTGAGCACTCGAAGCCTTCCGCAGACCGAGGCAGAATCGGTGGGTCTCACCTCG
CAGCTCACGGGAACAGAAGCCCGGCTTGTCGAGCTTTGGCGGTCGGTCATCTCGAAGGATGTTATCGCCATCCAT
GGACTAGAGCCCGAGTCCGACTTTTTCGCGGTTGGAGGCAACTCCATGCTGCTCGTGGAGTTGCAGCGGCAGATC
AAAGTGGAGTTCCGCACGGAAATTCCGCTAGTGCAGCTATTCGGAGCGACCACGGTGCAGAAGATGGCTCTCCTC
CTCGACCCGTCGACCGATGCGGCGAAAATTGCCGCTGGTCCCGTTGCTACAACGGCAGCAGCGCCCATCATTTGG
GAGCAGGAAATTCAGCTTCCCGACCAGCTTCAGCTGTCAACACCGATGGCCCCTACAACTCGATTAGAGAATCTG
AAAGGGCTCTGCATTGTGCTCACCGGTGCCACTGGATTTATCGGGCGAGCTCTCCTCCAGCGGCTGGTGGAAGAC
CCGGCCGTAGCCACCGTTCACTGCATTGCCGTCCGGGTTACGAGCACTCGGCGCCCTCCTCTGGTCACCGCAGGC
AAGATTATTGTGCACTACGGGGATCTTACGCTGCCGAGGTTGGGACTTGTAGAAGCCCAAGCCACCGCGATCTTC
AATGATGCTGACGCGGTGATCCACAACGGAGCCGATGTCAGCTTCCTCAAGAATTATCCGGCCCTTCGTCGAGCC
AACGTGGATTCGACCATCGAGTTGCTCCAGCTGGCGTGGCCGCGCCAGGTGCCAGTCCACTACGTTTCCACCAGC
GGCGTCGCCAATTTCACCCAATCCTCGACTTTCGCAGAGGTCTCCGCTGCCAGCGTCCTACCTCCGACCGATGGA
TCCCAGGGATACTTGAGTTCCAAGTGGGCCAGCGAGCGCGTGCTCGAAGAGGCGAACCGGAAAGCGGACTTCCCC
GTCTGGATACATCGCCCTTCCAGCGTCACTGGCGAGGGATCATCCCCCTTGGACTTGATGGACAATCTCCTCGAG
TTCTCTAGGAAACTACGTGCGGTTCCTCTCCCCGCGAAGTCCTCGTGGCAGGGCTATCTCGACTTTGTGCCTGTG
GAACAGGTGGCTCGGGATATTGTACGCGAGATTCTGGCACCTCGGGATCCCTCTCCCTTGAATCAGGTACGGTAC
CTTCACCATCTTGGGGAGCAGATCCCACTACATGGAATACAACGATACTTGGAGAAGGGTACGGGTGCATCGTAT
CGGGCATTACCCATGGGGGAGTGGTTGAAGGAGGCCCAGCAGGCAGGCCTCAGTGCACTGTTGGTCGAGTATCTT
GGTCAGATGGATAGACCTGACGTCAAAGTGGTGTTCCCACGGTTGGTGGCACGTCCACGACTTACATCGGGAGGG
CTGACGCGGCAAGGTTCTTGGGTGTCTAAGGGGGTAGCTATGTTGCTGACGTGGTAA
Transcript >Pro_DTO377G3_2|g2032.t1
ATGCCACCACTGTGCAGCCTTCCTGAGCCGATAGCCATCGTTGGCAGTGGCTGCAGATTCCCTGGGCAGAGCAAT
TCGCCGTCAAAGCTCTGGGAGCTGCTACGGGAGCCAAAAGACCTACAGACCGAAATTCCACCCAACCGTTTCAAT
CCTGATGGCTTCTACCACCCAGACAATCTTCATCATGGCACCAGCAATGTTCGCCATTCCTACCTACTGGAGGAG
GACTACCGTGTTTTTGACGCGCAATTTTTTGGAATCAAGCCTGCCGAAGCCAATTGTATTGACCCTCAGCATCGC
CTACTCCTCGAGACAGTCTATGAATCGGTTGACTCCGCTGGTTTGCGGCTGGAGGACCTCCGGGGTTCAGAAACA
GCAGTCTATGTCGGGTTGATGTGGGGGGACTATGCCGATATGATCGGCCGGGATCCTGAATCCTTCCCCATGTAC
ACTTCCACCGGAACCGCTCGAAGCATCATCTCGAACCGGATCTCTTATTTCTTTGACTGGCATGGGCCGTCTATG
ACGATTGACACGGCATGTTCGTCTAGTCTGGTAGCGGTCCATGAAGCTGTGCAAACACTTCGTGCCGGCCGCTCT
AGGGTTGCTGTAGCTGCTGGGTCAAACCTCTGTCTAGTGCCAGAGCCGTATATTGCGGAGAGTAAACTTCAAATG
CTTTCCCCAACCGGAAGAAGTCGTATGTGGGATGCCAAGGCGGATGGATATGCTCGTGGAGAAGGTGTCGCCGTT
GTAGTGCTCAAAACCTTGAGTGCTGCTTTGGAAGATGGCGATCACATTGAGTGTCTTATTAAGGAGACGGGCGTG
AACCAAGATGGTCGCACCAATGGCATTACTATGCCCAGCTCTACGGCACAGACAGCATTGATCCGTGCCACTTAC
GCCAACGTGGGACTAGATCCCCAAAAGAAAGAAGACCGCTGCCAATTCTTTGAAGCGCATGGAACGGGGACACCG
ACGGGCGACCCCCTGGAGGCAGCCGCCATTAGCAATGCTTTTTTTCCTGCAAGAGGAGAAGAAAATGATCGACTC
TACGTCGGTTCTATCAAGACAGTGGTCGGCCACACAGAAGGAACGGCAGGTCTAGCCGGTGTGTTGAAGGCATCA
TTAGCTCTTCAAAATCGCACTATTCCCCCGAATCTTCTTTTCAATCAACTCAACCCCAAGATCGAACCCTTTTAC
ACCAACCTGGAGATAACTACAACGGCGAAGCCCTGGCCAGTACTGCCGTCGGGTGTACCGCGCCGGGCGAGTGTA
AACAGTTTCGGCTTTGGAGGAACCAATGCGCATGCAATCTTGGAGGCATATGAGCGTCCTGTCGTCCCGCGGGAT
CGAGATCAGGTCAACTTCACGCCATTCATCCTCTCTGCCACTTCTGAGGCCTCTCTCACCCGAAATTTGACATCG
TTCGCGGAATATCTCCAGGAAAACCCCGCGGTGAATATCCGAGATGTTTCCTGGACGCTGTACTCGCGCAGATCT
CGTCTCGCTTTCTCCACGATTGTCGCTGGTGCAACGACAGAACGCCTACTGGCCAACATTCAAGCCCGCCTTGAG
GAAACAGACGCTAAAGCCCCCCTCGCTGTGAGACACCACCAGTCTCAAACGGAGAACCCTCGAGTACTCGGAGTC
TTCACAGGCCAAGGTGCCCAGTGGGCCACGATGGGACGCGAGTTACTGAAGTCGGCCAAGGTCCGAGAGATTGTG
CAGGGCTTGGATCTTGCTCTCCAACGTCTTCCAAGCAACGACCGCCCGAGATGGACTTTGTTGAAGGAGTTTATG
ACCGATGCGTTGGCGTCGCGCATCAAGGAGGCCGAGATCTCCCAGCCAATGTGCACGGCGGTGCAAATTATCCTA
GTGCAGCTGCTGCGTGGTGCTGGTGTCACCTTGGATTCGGTAGTTGGCCACTCCTCCGGGGAGATTGCTGCGGCC
TATGCAGCCGGGTTTTTCTCCGCAGACGATGCCATCTGTATAGCCTACTATCGTGGGTTGTGCTCTCGGTCGGCT
CGAGGCCCCGATGGACAGAAAGGAGCCATGATGGCCGTCGGAACCTCCCTTGAAGATGCTCTTGAGCTCTGCAAG
GAGCCTGAGTTCCACGGACGGATTTCGGTGGCCGCAGTCAATTCCTCGGCCAGTGTCACACTGTCCGGTGATGCC
GAAGCAATTGAGCAAGCCAAAGCCGTTTTTGATGAAGAGAAAAAGTTCGTTCGCATATTGGCCGTGGACAAGGCC
TATCACTCCCACCACATGAGAGCCTGCTCCGATCAATATATTTCCTCCTTGAAAAACTTGAATATCAAAATCGGC
CATCCGCCACCCTCAGCCCCCGTCTGGTACTCCAGCGTGCGGGAAGGGAACATAACAGTCGCAGGAGCGCTCGAT
CTTGCAGACACATACTGGAGCGATAACATGGTCCACCCAGTCCTCTTTGCTCAAGCGGTTGAAAGCGCCACCGCT
GGCCATGGCCCGTTTACTTTAGCAATTGAAGTGGGACCTCATCCTGCCCTGCGTGGCCCAACTTTGCAGATAATA
CAAGACTTGCTTGACGCGTCCTTGGACTACACAGGGACGTTGCAGCGAGGCTCCCATGATCTCGAAGCGATGAGT
GGTTGCCTAGGATACCTATGGCAGACGCTGCCGCCGTCCAGTGTGGATCTGTGTAGGTACGATGCGCTACTATCG
GATGGGTCTCAACCGCAAATTGTCAAAGACATGCCTTCGTACGCTTGGGACCATGATCGCATATTCTGGTACGAA
TCGCGGCTATGGAAGGCGACCAGGAGTAGATCGACTCCAGTCCATCCCCTCCTGGGCTCTCGGTGCCCGGATGGA
GTGGAGCAAGAATTCCGCTGGCGGAATTTCTTGAGCCCCCGTGAGGTCCCTTGGCTCTCAGGCCATCAGATTCAG
GGACAGATGGTTTTCCCTGGGGCTGGCTATGTATCTTCGGCGGTGGAAGCAGCGAAGAATATGGCGCCCAACGAG
ACTATTCGGCTGGTCGAGTTGGAGGACCTAGTCATCCGCCAGGCGATGATCTTCGACAATGAAAGTTCATCCGTG
GAGACGCTTGTTTCTATCACAAATATCATCCACAAACAGAAGGACACGGTGCTGGCCAACTTCGCCTTCTACTCT
GCCGTCGGGCAGGAGTCGACCGCCATGACCATGAACGCTTCAGGACGTCTCATAATCACCTACGGCACCCCCACT
CCAGATGCGCTACCGGTGCGGCGACCATCCCTTGTCGATATGATTGATGTTCCTAGTGAAAGGTTTTACAACTCG
CTGGACCCTATCGGATACAGCTATACGGGCCCATTCCGAGCGCTAACCGACATGAAGAGGAAACTGGGTATCGCG
ACAGGTTTTGTCAACCGAGAACCTACCCCCGATTCAGCCTCTCTGACCTTGCACCCGGCCATGCTAGATGCGTCC
ATTCAGGCCGTTTTGCTTGCCAAAAGCTTCCCCGGTGATGGGCAATTGTGGTGTCTTCAAGTTCCCAAGGTGATC
CGGCGGGTGGCTGTGAATCCAAGCTTGTGTGTCTCATATGACCCAATTGTGCAGACTGCTTTCCAGCTTGATGCT
GTGTTAACTCAAATGGAGGCTTCTGACACCTTGGGTGATGTTGATATCTACTCTCCGGATGGTCAGCACACGCTT
GCCCGCATGGAAGGCATACATGCTGTGCCTCTTGAAGCTGCTAGCGCTGCCAGTGATCGGCCATTTTTCAGCTCA
ATGGTCTGGAGCCCTTCATCGCCAGATACAGAGTCGGTGACCTTTGCTGGGAAAGCCACCAACGAGGACTATGAG
CTCGCCTATGTCCTGGAAAGAGTGTCAATATTCTATCTCCGCCAACTCCATCTTAAATTTCCCGCCACTCACCAA
GCTCGTCACGAGGGTCCCTACCTCGGCCTGCTTCGATTTGCATCCCATGTTTCTGGCTTGGTTGAGAATGATCGG
CACCGTTACGCTCAACGGAGCTGGATCCATGATACTCACGCCGTAATTATGCGTGAAAGCCAAAGGTTCCCCGAC
AATGTCGATCTTGCTGTGATGCAGATCATTGGGGAACACATGGCGAAAGTCATCGAGGGTCAATCCACCATCCTG
GAGTATCTCACAAAGGACAACCTCCTGAGTAGATACTATGAAGAAGCCATGGGAATTGGCTACTTCAGTGATTAC
CTTGCTGGTGTAGTAGCTCAGATTGTGCATCGTTATCCCCACATGAGAATCCTTGAAATCGGTGCTGGTACCGGT
AGTGCGACGAAGAAAGTCATCAGCACCGTTGGTCGTAGCTTTTCTAGCTATACATTCACTGATATATCCAACGGG
TTCTTTGAGAATGCCAGGGAACTGTTCTCTAGCCATTCCGGCCAGATGCTCTTCAAAGTCCTCGACGCAGAGAAG
GATATTACTTCTCAAGGGTTCCATGAAGAATCCTACGACGTCATTGTTGCATCCTTTGTCCTGCATGCGACTTCG
AGATTGGAACACACCCTGAATAACATCCGACGCCTGCTGAAACCCGGGGGGTATTTGGTCATGCTAGAGGTCACC
AACCTGGAGCAGTCACGTCTAGGATATATATTTGGATCGTTTCCCGGCTGGTGGCTCGGTGCTGACGATGGCCGG
GTACTCTCCCCTTGCGTGACCACGGACGAATGGGATCGGTTACTGCGCAAGACTGGTTTTTCTGGGATTGATAGT
ATTACACCAGATGCGGATGCACTTCCATTCCCGGCGTCTGCCATCGTCTCCCAAGCGATCGATCCCACTGTCCAG
TTCCTCCGCGATCCCCTGGAATCTAGCGGTGAGTTCCTAGATTCCAAAACGGATATTCTAGTCGTTGGCGGCGCC
TCAGATGCAGTGCATAACGTGCGCAAGGAAATTCTTTATCATCTTAAATCCCGTTTCGATCATGTATCGGTTATA
GACTGTCTGCAAGATCTCAGCAAAGCACCCACTTCCTCCGGATACTTTACGCTGAATCTTTCGGATCTAGACGAG
CCTGTCTTCAAGAACATGACCGCAGAGGCGTTGGCTGGTCTGAAGCTCATCTACGAACGATCAGCTTATCTTCTT
TGGGTGACTGAGGATTCTCGCGCTGGGAATATTCACCAAAATCAGAGCCTTGGCTTTGGTCGCTCAATGACCGTT
GAAATGCCCCATGTTCAATCCCAATTCCTAGATTTGGACTCGGTGAGTTCGTCTGGAGCTGCCCTAATTATTGCA
CGAGCTATCCTGCGCTTTATCGGTGTGAACATATCAGACAATCCCGAGCGAGCAAATAGGCTGCTCTGGAGCACC
GAGCAAGAATTGGCTGTGATCCGAGATAAGGAGTTCATTCCACGTATCCTACTCAATAATGCCCAAAATCTGCGG
TACAATGCATCGAGGCGAGCAATTGCGGAAGAGGTCGACCTCCGCTCCAAGATTGTGACGGTAAAGGGGAATGCG
GGGGCTTATGTCGTTGAACATGGCTCTGAGTATGACTCTCCCGCTACTCCCCCAGGCTCGAAAAGAATTAGTGTC
GAGGCATCTTCTCTAAAGGCGGTCCGTCTACTTAGCGGTAATGATCTATATTTGGTCGCCGGCACAGTTGTTGCA
ACGGGTGAGAAAGTCTTTGGTTTTGCTGCAAGGAACTCTTCAGTGGTCGACATTCCCAGCAGCTGGACCATTCCT
AGCGACGACTCCCCCACGAAGTTGCTACCGTTCGCGGCCGCCCATGCTGTTGCGCGCTCCATTGTATCGTCTGCC
CACAGCCATACAGCACTGATCGTGATTGAGCCTGAGAAGGTCGTTTCATCGGCACTAGCATTCCATGCCTCTCAG
AGAGGCTTACGCATTATCTTCTTGACCTCAGATGGGAATCACATGCAGCCATCCTGGATTGTTGTGCATCCGCAC
ACTCACGTACGATCATTGCAACAGTTACTGCCCAACGAGCCGGTGATGGTCCTGGACATGCGACCCGGCGCTGAG
GGCAGCAGCCTGACGTTGAAGCTTCGCTCGGCATTGCACTCGTCGTCTACCTTTGAGCGGCTCGCTAATTTCTGC
AGCGATACCGTGCGAAGTTCAGAGGAGCACATCCCTACTGAGACTATACAGATGATAGCCACGGAGAGACACCAT
GATGCCGCTACCATGAGACAAGCAGAGCAGGTCTTCATCCCACTCCAGGATATCAGTAGCCTATCTCTGAACCAA
TCTGCATTCTCCTTCATCGACTGGACATCCACTTCAACGGTTTCTTCCCTGATTCGCAGGGTTGACCATTATCCC
TTTTTGCGCAATGACAGGACATACTGGCTTGTCGGTCTGACGGGATCCCTGGGTTTGTCCCTTTGTCAATGGTTG
ATTTGGCAAGGCGCCATGAACGTGGTACTGACTAGCCGAAACCCCAACATCGATCCTACAATTCTCCAGGAGCTC
AGAACCTCTGGAGCTAGAGTTGAAGTATATGCCGGCGACGTGACGGACCGAGAGAGTCTGCGGTCAGTATATGAC
CGCATCTGTCGGAATCTTCCCCCAATTGCTGGAGTGGCTCAGGGAGCGATGGTGCTGCAAGACACCATGGTTAAG
GACATGGACATCGAAGCTATGCAAAAGGTGTTGAAACCGAAGGTGACCGGCAGCATTCATCTGGATGAGTTGTTC
TCCCACATCCATCCTCTAGACTTCATGATTTTCTTCTCCTCTGCAACTTGCGTCACAGGTAATATCGGCCAGTCC
AACTACGCCGCTGCCAATATGTTCATGACCGCACTAGCAGCGAACCGCAAACAGCGCGGGCTAGCAGGTTCTGTC
ATAAATATTGGAGCGATCATGGGAGTCGGCTATGTCACTCGTGAAACGAGCGAGGCGCTGCAAAGAAATCTTCTG
AAGAGTGGTCATGTGTGGATGTCAGAAGGCGACTTCCATACAATATTCGCAGAGGCTATCCTCGCTGGGTCTCCT
AGTTCCAACGCCACGGTGGAGCTCACATGTGGGCTGCGTATTATCAGAGATGTTGATGAGCAGCGTCCGTTATGG
TCATACAGCCCGAAATTCCAGCATCTAGTCGTTCTCGACGAGTTGTCCACAGAAACCGATGGCGACTCCAAGAGG
CAGATGCCGCTTCGACTACAGCTTCTTGAGGCAAGAACAGCTGATGAGATCTCCAAGATTGTTCAAGAATCTTTC
TTTGCTAAGCTCCAGATTATGCTGGGTTTGCATGATGTGGCCAGCAGTTCTATCCTCGATAAAGCTGCAGATGAG
CTTGGAATCGATTCATTGAACACTGTCGAAATCAGATCCTGGTTCTTGAAGGAACTGAAAGTTGACATCCCGGTA
CTACGCATTTTGGGAGGTGCCACCATTGACGACATTCTCCACTTCGCCTTAGATAGGCTTCCTACCGAGATGACC
CCAAACATTGGAGCTGCTCCTGTGCCGCGGGTTGGTGAGGCTGTTGTTAGACAGCAATCTGAGATTCAATCCCGG
ACTTCGGAACGGAAGCTTGGCAGTATTCCCAAGTTGGCTAGTTCTGCGGACCCTGTTGCTCGGCCAAGACCCGGT
GGACCTGGACGGACTGTCTCCTCAAAGTCTCTTTCGAATGGCCAAAGTTCATCTACGCGGGCAAGCACCACCTCC
AGTCTCGTTGATATATCCCGAGGCGAGGACACTTCATCCGGGTCCTTCAGCATCATCGAAACGCCTTCATTCAGT
GAAGATGAGCATAATTTGCCGCTTCCGGATAACCCGAGCCAGGCCAATCTCCTGAAGCAGCCGGGCGACAGTGTC
CACTCGGCGTTACGGAAGGAGCCACTCTCCTTTGCACAATCTCGTTTCTGGTTCCTCCGCTTATACCTTGAGGAT
CAGACTACCTTTAATATCACTTGTTCATTACGAATCCAGGGCGCCTTTTCAGTTGATGCCCTTGAGCGAGCAGTT
CAAGGGGTGGGCCAACGACATGAAGCCCTAAGAACATGCTTTTCTGCGGAGGATGGAGAATCACCTACGCAAATC
ATCCTGCCACACTCAACGTTGTCTCTGGAAAGGAAGACTTATCACACAATGTCTGAAGTTGAGGCTACTATGCGA
GAGGTTAAGAATCACATCTACGACCTTGAGCATGGACAGCTAATGAGGGTGCTTCTGTTGTGCCCTGCGGTGTTG
GCAACACCCCTGGTGCACTTCCTGATAATTGGATACCACCATATCAACATGGATGGTGTTAGCCTGGAGGTGATT
CTCTCTGAACTGCAAAACACCTACGAAGGACGTTCTCTCAGTACGCGAGTACTTCAGTACCCCGATTACGCGGCC
AAACAACGTCAGCAGCGAAATAACGGCTCGTGGAATGAAGACTTGGCCTTCTGGAGAGAGAGATTTCCCGAACCC
CCAGCGGACTTTCCATTACTGCCTTTCGCGTGTGTATCTGACCGCCAAGCTCTGTTACGATATGGTCATCACCGA
GTGCAACAACGCCTGAACCCAAGTCTAGGAAGACAAATCCGCCAGTTTTGCCAATCTGTCAAATGCACGCCTTCG
CATTTCTATCTTGCAGCATTCCAGGCACTGCTCTGTCGACTCGCTGAGACCCAGGATATCTGCATCGGCATGGCT
GATGCCAACCGTATTCAGGTAGAAGCAGCTGACAGCGTGGGGCCATACTTGAATCTGCTCGCCCTACCTTTGCAC
TATGATGCCAACACGCCTTTCGTTGAGTTAACTCGATCAGCTCGTAAGAAGGTCTACAGTTCTTTAGCTCACTCA
CAGGTGCCATTCGATATTCTGCTATCCGAACTCAAGGTTCCGAGATCGCCATCCCATAACCCGTTGTTCCAAGTT
TTCATGGATTATCGGCAGGATGTCCGCGAGAAACGGCAGTTCGGAGAATGTCTATTCGAAGGTCTAGATTATGAA
ATGGGTCGAACATCCTACGATGTTGCTTTGGATATTGTCGACAAAGTGGAAGGCGAGCCATTGGTCATTCTTGGC
CTCCAGCAATCCCTATACAGTACCGAAGCAGCTGAGACTCTTCTGAACGCCTTTCTAAACATGGTCGCAGTCTTT
GCCAATGATCCATCTACCCCCGTGGGCCAGGCGTCTATATTCGCTGTAAAGGATGTTCAAAGGTCCCTTGCACTC
AGCCAAGGCCCGACAGTGCCCAGCCGATGGCCAGCAACGCTCCCCCATCGTATTGACACGATGGTGCAACGGTTC
CCCAAGAAACTTGCTTTGAAAGACGGCCTCAACAACCGATTCACTTTTGAGGAAATGAGTCAACGAATCGACTCA
ATTGCGTTCGCTCTGTTAGGCGCCAACGTCAGCCGTGGCCAACGTGTGGGTGTGTTTCAGCATCCAACGGCCGAC
TGGATCTGTTCTATGCTGGCCATTCTGCGAGTGGGAGCTACTTATGTTCCGCTCGATCTTCGGCTCGAAATTCCA
CGTCTCAAATCGATCTGTGATGACTGTAAGCCTATGGTCCTTCTCGTGGACAATGAGACGAAAGATCAAGTGGAC
GAATTGGGGTGTTCGAACGCACTGTCAATGAACATCTACGATTTACCAATGTCCTTCCCTATCCCTGTCGTCAAT
CGTGCCGTCTTGGAAGATCCAGCCGTGATATTTTATACTAGCGGTTCGACTGGTGCTCCCAAAGGCATTGCATTG
ACCCACGAGAACCTGCGCGTCAACGTCGAAGGAAACCAGGAGGAGTTCCGACTCTGGCCGCACGATCACCTGCTG
CAGCAAATTGCTTTCAGCTTTGACTTTTCGGTATGGCAGGTGTTCATGGCGTTGGCAAACGCCGCTTCGCTTTTC
ATTGCCCCGCTGTCTAAACGTGGTGATCCGGTGGCCTTGGTGGAATCGATTCTTACGGAGGGTATCACCGTCGCA
GGGGCCACTCCTTCCGAATATCACAGTTGGTTTATGCACGGTGATTTGTCGGGTCTCAAGAAGTCCAAATGGAGG
ACTGCGGTCAGTGCAGGGGAGCCGATGACTTCGAGCATGATTCATGATTTCCAAGAGTTGAACAAGCGGGATCTT
CGACTTTTCAACGGGTACGGCCCAACCGAAGCCAGCATGTCTTCCAACAAACTGCAAGTGCCGTACCTCCGCAGC
AAAACCCAGAGTCCACAGGAGTGGATGCACCGTGGGTCGGTCGTCGCCGGATACACGGCCCCGAATTACTCCATC
TACATAGTCGACGAAGCGCTCAACCCCGTTCCCGTTGGTATTCCAGGCCAGATACTTATTGGTGGTCCTGGGATC
GCGCATGGGTACTTGAACAACGAGGATCTATCACGCAGTCGCTTCATGGAGGACCGATTCGCCACGGCCGAACAA
AAGGCTCAAGGATGGCGACGGGTTCACCTCACCGGCGATCGCGGGCGAATCCGGCCAGACGGACAACTTCAAATC
GAGGGTCGGATTAACGGGGACACCCAGGTGAAGTTGCGCGGCTACCGCGTCGACTTGCGCGATATCGAAACGGTG
ATCCTTCAATCATCGCAAGGGATGCTTAAGGAGGCCGTCGTCACTCTCTATACAGGCTCCAATACCAACACGGAA
CTGCTGGTCGCTTATGTGATTTTCCTTGCCGGATATCCTGTGGAGCAACGCAAGCAATCCTTGCGGGAACTTAGC
AAATCTCTGCCTCTGCCTCGTTACATGTGGCCGTCCATGGTGCTCCCCGTGGATGACATGCCAGTCACAGCCCAC
GGCAAGCTTGACCGCAAGGCCTTGAGCACTCGAAGCCTTCCGCAGACCGAGGCAGAATCGGTGGGTCTCACCTCG
CAGCTCACGGGAACAGAAGCCCGGCTTGTCGAGCTTTGGCGGTCGGTCATCTCGAAGGATGTTATCGCCATCCAT
GGACTAGAGCCCGAGTCCGACTTTTTCGCGGTTGGAGGCAACTCCATGCTGCTCGTGGAGTTGCAGCGGCAGATC
AAAGTGGAGTTCCGCACGGAAATTCCGCTAGTGCAGCTATTCGGAGCGACCACGGTGCAGAAGATGGCTCTCCTC
CTCGACCCGTCGACCGATGCGGCGAAAATTGCCGCTGGTCCCGTTGCTACAACGGCAGCAGCGCCCATCATTTGG
GAGCAGGAAATTCAGCTTCCCGACCAGCTTCAGCTGTCAACACCGATGGCCCCTACAACTCGATTAGAGAATCTG
AAAGGGCTCTGCATTGTGCTCACCGGTGCCACTGGATTTATCGGGCGAGCTCTCCTCCAGCGGCTGGTGGAAGAC
CCGGCCGTAGCCACCGTTCACTGCATTGCCGTCCGGGTTACGAGCACTCGGCGCCCTCCTCTGGTCACCGCAGGC
AAGATTATTGTGCACTACGGGGATCTTACGCTGCCGAGGTTGGGACTTGTAGAAGCCCAAGCCACCGCGATCTTC
AATGATGCTGACGCGGTGATCCACAACGGAGCCGATGTCAGCTTCCTCAAGAATTATCCGGCCCTTCGTCGAGCC
AACGTGGATTCGACCATCGAGTTGCTCCAGCTGGCGTGGCCGCGCCAGGTGCCAGTCCACTACGTTTCCACCAGC
GGCGTCGCCAATTTCACCCAATCCTCGACTTTCGCAGAGGTCTCCGCTGCCAGCGTCCTACCTCCGACCGATGGA
TCCCAGGGATACTTGAGTTCCAAGTGGGCCAGCGAGCGCGTGCTCGAAGAGGCGAACCGGAAAGCGGACTTCCCC
GTCTGGATACATCGCCCTTCCAGCGTCACTGGCGAGGGATCATCCCCCTTGGACTTGATGGACAATCTCCTCGAG
TTCTCTAGGAAACTACGTGCGGTTCCTCTCCCCGCGAAGTCCTCGTGGCAGGGCTATCTCGACTTTGTGCCTGTG
GAACAGGTGGCTCGGGATATTGTACGCGAGATTCTGGCACCTCGGGATCCCTCTCCCTTGAATCAGGTACGGTAC
CTTCACCATCTTGGGGAGCAGATCCCACTACATGGAATACAACGATACTTGGAGAAGGGTACGGGTGCATCGTAT
CGGGCATTACCCATGGGGGAGTGGTTGAAGGAGGCCCAGCAGGCAGGCCTCAGTGCACTGTTGGTCGAGTATCTT
GGTCAGATGGATAGACCTGACGTCAAAGTGGTGTTCCCACGGTTGGTGGCACGTCCACGACTTACATCGGGAGGG
CTGACGCGGCAAGGTTCTTGGGTGTCTAAGGGGGTAGCTATGTTGCTGACGTGGTAA
Gene >Pro_DTO377G3_2|g2032.t1
ATGCCACCACTGTGCAGCCTTCCTGAGCCGATAGCCATCGTTGGCAGTGGCTGCAGATTCCCTGGGCAGAGCAAT
TCGCCGTCAAAGCTCTGGGAGCTGCTACGGGAGCCAAAAGACCTACAGACCGAAATTCCACCCAACCGTTTCAAT
CCTGATGGCTTCTACCACCCAGACAATCTTCATCATGGCACCAGCAATGTTCGCCATTCCTACCTACTGGAGGAG
GACTACCGTGTTTTTGACGCGCAATTTTTTGGAATCAAGCCTGCCGAAGCCAATTGTATTGACCCTCAGCATCGC
CTACTCCTCGAGACAGTCTATGAATCGGTTGACTCCGCTGGTTTGCGGCTGGAGGACCTCCGGGGTTCAGAAACA
GCAGTCTATGTCGGGTTGATGTGGGGGGACTATGCCGATATGATCGGCCGGGATCCTGAATCCTTCCCCATGTAC
ACTTCCACCGGAACCGCTCGAAGCATCATCTCGAACCGGATCTCTTATTTCTTTGACTGGCATGGGCCGTCTATG
ACGATTGACACGGCATGTTCGTCTAGTCTGGTAGCGGTCCATGAAGCTGTGCAAACACTTCGTGCCGGCCGCTCT
AGGGTTGCTGTAGCTGCTGGGTCAAACCTCTGTCTAGTGCCAGAGCCGTATATTGCGGAGAGTAAACTTCAAATG
CTTTCCCCAACCGGAAGAAGTCGTATGTGGGATGCCAAGGCGGATGGATATGCTCGTGGAGAAGGTGTCGCCGTT
GTAGTGCTCAAAACCTTGAGTGCTGCTTTGGAAGATGGCGATCACATTGAGTGTCTTATTAAGGAGACGGGCGTG
AACCAAGATGGTCGCACCAATGGCATTACTATGCCCAGCTCTACGGCACAGACAGCATTGATCCGTGCCACTTAC
GCCAACGTGGGACTAGATCCCCAAAAGAAAGAAGACCGCTGCCAATTCTTTGAAGCGCATGGTAAGTTTTGCTCT
TAAGGATACGGATAAGCTGTCGAATCATCCCGGCTAATGAACATTATCAGGAACGGGGACACCGACGGGCGACCC
CCTGGAGGCAGCCGCCATTAGCAATGCTTTTTTTCCTGCAAGAGGAGAAGAAAATGATCGACTCTACGTCGGTTC
TATCAAGACAGTGGTCGGCCACACAGAAGGAACGGCAGGTCTAGCCGGTGTGTTGAAGGCATCATTAGCTCTTCA
AAATCGCACTATTCCCCCGAATCTTCTTTTCAATCAACTCAACCCCAAGATCGAACCCTTTTACACCAACCTGGA
GATAACTACAACGGCGAAGCCCTGGCCAGTACTGCCGTCGGGTGTACCGCGCCGGGCGAGTGTAAACAGTTTCGG
CTTTGGAGGAACCAATGCGCATGCAATCTTGGAGGCATATGAGCGTCCTGTCGTCCCGCGGGATCGAGATCAGGT
CAACTTCACGCCATTCATCCTCTCTGCCACTTCTGAGGCCTCTCTCACCCGAAATTTGACATCGTTCGCGGAATA
TCTCCAGGAAAACCCCGCGGTGAATATCCGAGATGTTTCCTGGACGCTGTACTCGCGCAGATCTCGTCTCGCTTT
CTCCACGATTGTCGCTGGTGCAACGACAGAACGCCTACTGGCCAACATTCAAGCCCGCCTTGAGGAAACAGACGC
TAAAGCCCCCCTCGCTGTGAGACACCACCAGTCTCAAACGGAGAACCCTCGAGTACTCGGAGTCTTCACAGGCCA
AGGTGCCCAGTGGGCCACGATGGGACGCGAGTTACTGAAGTCGGCCAAGGTCCGAGAGATTGTGCAGGGCTTGGA
TCTTGCTCTCCAACGTCTTCCAAGCAACGACCGCCCGAGATGGACTTTGTTGAAGGAGTTTATGACCGATGCGTT
GGCGTCGCGCATCAAGGAGGCCGAGATCTCCCAGCCAATGTGCACGGCGGTGCAAATTATCCTAGTGCAGCTGCT
GCGTGGTGCTGGTGTCACCTTGGATTCGGTAGTTGGCCACTCCTCCGGGGAGATTGCTGCGGCCTATGCAGCCGG
GTTTTTCTCCGCAGACGATGCCATCTGTATAGCCTACTATCGTGGGTTGTGCTCTCGGTCGGCTCGAGGCCCCGA
TGGACAGAAAGGAGCCATGATGGCCGTCGGAACCTCCCTTGAAGATGCTCTTGAGCTCTGCAAGGAGCCTGAGTT
CCACGGACGGATTTCGGTGGCCGCAGTCAATTCCTCGGCCAGTGTCACACTGTCCGGTGATGCCGAAGCAATTGA
GCAAGCCAAAGCCGTTTTTGATGAAGAGAAAAAGTTCGTTCGCATATTGGCCGTGGACAAGGCCTATCACTCCCA
CCACATGAGAGCCTGCTCCGATCAATATATTTCCTCCTTGAAAAACTTGAATATCAAAATCGGCCATCCGCCACC
CTCAGCCCCCGTCTGGTACTCCAGCGTGCGGGAAGGGAACATAACAGTCGCAGGAGCGCTCGATCTTGCAGACAC
ATACTGGAGCGATAACATGGTCCACCCAGTCCTCTTTGCTCAAGCGGTTGAAAGCGCCACCGCTGGCCATGGCCC
GTTTACTTTAGCAATTGAAGTGGGACCTCATCCTGCCCTGCGTGGCCCAACTTTGCAGATAATACAAGACTTGCT
TGACGCGTCCTTGGACTACACAGGGACGTTGCAGCGAGGCTCCCATGATCTCGAAGCGATGAGTGGTTGCCTAGG
ATACCTATGGCAGACGCTGCCGCCGTCCAGTGTGGATCTGTGTAGGTACGATGCGCTACTATCGGATGGGTCTCA
ACCGCAAATTGTCAAAGACATGCCTTCGTACGCTTGGGACCATGATCGCATATTCTGGTACGAATCGCGGCTATG
GAAGGCGACCAGGAGTAGATCGACTCCAGTCCATCCCCTCCTGGGCTCTCGGTGCCCGGATGGAGTGGAGCAAGA
ATTCCGCTGGCGGAATTTCTTGAGCCCCCGTGAGGTCCCTTGGCTCTCAGGCCATCAGATTCAGGGACAGATGGT
TTTCCCTGGGGCTGGCTATGTATCTTCGGCGGTGGAAGCAGCGAAGAATATGGCGCCCAACGAGACTATTCGGCT
GGTCGAGTTGGAGGACCTAGTCATCCGCCAGGCGATGATCTTCGACAATGAAAGTTCATCCGTGGAGACGCTTGT
TTCTATCACAAATATCATCCACAAACAGAAGGACACGGTGCTGGCCAACTTCGCCTTCTACTCTGCCGTCGGGCA
GGAGTCGACCGCCATGACCATGAACGCTTCAGGACGTCTCATAATCACCTACGGCACCCCCACTCCAGATGCGCT
ACCGGTGCGGCGACCATCCCTTGTCGATATGATTGATGTTCCTAGTGAAAGGTTTTACAACTCGCTGGACCCTAT
CGGATACAGCTATACGGGCCCATTCCGAGCGCTAACCGACATGAAGAGGAAACTGGGTATCGCGACAGGTTTTGT
CAACCGAGAACCTACCCCCGATTCAGCCTCTCTGACCTTGCACCCGGCCATGCTAGATGCGTCCATTCAGGCCGT
TTTGCTTGCCAAAAGCTTCCCCGGTGATGGGCAATTGTGGTGTCTTCAAGTTCCCAAGGTGATCCGGCGGGTGGC
TGTGAATCCAAGCTTGTGTGTCTCATATGACCCAATTGTGCAGACTGCTTTCCAGCTTGATGCTGTGTTAACTCA
AATGGAGGCTTCTGACACCTTGGGTGATGTTGATATCTACTCTCCGGATGGTCAGCACACGCTTGCCCGCATGGA
AGGCATACATGCTGTGCCTCTTGAAGCTGCTAGCGCTGCCAGTGATCGGCCATTTTTCAGCTCAATGGTCTGGAG
CCCTTCATCGCCAGATACAGAGTCGGTGACCTTTGCTGGGAAAGCCACCAACGAGGACTATGAGCTCGCCTATGT
CCTGGAAAGAGTGTCAATATTCTATCTCCGCCAACTCCATCTTAAATTTCCCGCCACTCACCAAGCTCGTCACGA
GGGTCCCTACCTCGGCCTGCTTCGATTTGCATCCCATGTTTCTGGCTTGGTTGAGAATGATCGGCACCGTTACGC
TCAACGGAGCTGGATCCATGATACTCACGCCGTAATTATGCGTGAAAGCCAAAGGTCGGTCATGTTTCACTAAAC
GATATTTTTCTTTTGCTAAGGAGTTTTTAGGTTCCCCGACAATGTCGATCTTGCTGTGATGCAGATCATTGGGGA
ACACATGGCGAAAGTCATCGAGGGTCAATCCACCATCCTGGAGTATCTCACAAAGGACAACCTCCTGAGTAGATA
CTATGAAGAAGCCATGGGAATTGGCTACTTCAGTGATTACCTTGCTGGTGTAGTAGCTCAGATTGTGCATCGTTA
TCCCCACATGAGAATCCTTGAAATCGGTACGTACATTCCCGCACGAATCGTCAACGAGAGACTTTACTAAATTAA
TGGATTACTTGTAGGTGCTGGTACCGGTAGTGCGACGAAGAAAGTCATCAGCACCGTTGGTCGTAGCTTTTCTAG
CTATACATTCACTGATATATCCAACGGGTTCTTTGAGAATGCCAGGGAACTGTTCTCTAGCCATTCCGGCCAGAT
GCTCTTCAAAGTCCTCGACGCAGAGAAGGATATTACTTCTCAAGGGTTCCATGAAGAATCCTACGACGTCATTGT
TGCATCCTTTGTCCTGCATGCGACTTCGAGATTGGAACACACCCTGAATAACATCCGACGCCTGCTGAAACCCGG
GGGGTATTTGGTCATGCTAGAGGTCACCAACCTGGAGCAGTCACGTCTAGGATATATATTTGGATCGTTTCCCGG
CTGGTGGCTCGGTGCTGACGATGGCCGGGTACTCTCCCCTTGCGTGACCACGGACGAATGGGATCGGTTACTGCG
CAAGACTGGTTTTTCTGGGATTGATAGTATTACACCAGATGCGGATGCACTTCCATTCCCGGCGTCTGCCATCGT
CTCCCAAGCGATCGATCCCACTGTCCAGTTCCTCCGCGATCCCCTGGAATCTAGCGGTGAGTTCCTAGATTCCAA
AACGGATATTCTAGTCGTTGGCGGCGCCTCAGATGCAGTGCATAACGTGCGCAAGGAAATTCTTTATCATCTTAA
ATCCCGTTTCGATCATGTATCGGTTATAGACTGTCTGCAAGATCTCAGCAAAGCACCCACTTCCTCCGGATACTT
TACGCTGAATCTTTCGGATCTAGACGAGCCTGTCTTCAAGAACATGACCGCAGAGGCGTTGGCTGGTCTGAAGCT
CATCTACGAACGATCAGCTTATCTTCTTTGGGTGACTGAGGATTCTCGCGCTGGGAATATTCACCAAAATCAGAG
CCTTGGCTTTGGTCGCTCAATGACCGTTGAAATGCCCCATGTTCAATCCCAATTCCTAGATTTGGACTCGGTGAG
TTCGTCTGGAGCTGCCCTAATTATTGCACGAGCTATCCTGCGCTTTATCGGTGTGAACATATCAGACAATCCCGA
GCGAGCAAATAGGCTGCTCTGGAGCACCGAGCAAGAATTGGCTGTGATCCGAGATAAGGAGTTCATTCCACGTAT
CCTACTCAATAATGCCCAAAATCTGCGGTACAATGCATCGAGGCGAGCAATTGCGGAAGAGGTCGACCTCCGCTC
CAAGATTGTGACGGTAAAGGGGAATGCGGGGGCTTATGTCGTTGAACATGGCTCTGAGTATGACTCTCCCGCTAC
TCCCCCAGGCTCGAAAAGAATTAGTGTCGAGGCATCTTCTCTAAAGGCGGTCCGTCTACTTAGCGGTAATGATCT
ATATTTGGTCGCCGGCACAGTTGTTGCAACGGGTGAGAAAGTCTTTGGTTTTGCTGCAAGGAACTCTTCAGTGGT
CGACATTCCCAGCAGCTGGACCATTCCTAGCGACGACTCCCCCACGAAGTTGCTACCGTTCGCGGCCGCCCATGC
TGTTGCGCGCTCCATTGTATCGTCTGCCCACAGCCATACAGCACTGATCGTGATTGAGCCTGAGAAGGTCGTTTC
ATCGGCACTAGCATTCCATGCCTCTCAGAGAGGCTTACGCATTATCTTCTTGACCTCAGATGGGAATCACATGCA
GCCATCCTGGATTGTTGTGCATCCGCACACTCACGTACGATCATTGCAACAGTTACTGCCCAACGAGCCGGTGAT
GGTCCTGGACATGCGACCCGGCGCTGAGGGCAGCAGCCTGACGTTGAAGCTTCGCTCGGCATTGCACTCGTCGTC
TACCTTTGAGCGGCTCGCTAATTTCTGCAGCGATACCGTGCGAAGTTCAGAGGAGCACATCCCTACTGAGACTAT
ACAGATGATAGCCACGGAGAGACACCATGATGCCGCTACCATGAGACAAGCAGAGCAGGTCTTCATCCCACTCCA
GGATATCAGTAGCCTATCTCTGAACCAATCTGCATTCTCCTTCATCGACTGGACATCCACTTCAACGGTTTCTTC
CCTGATTCGCAGGGTTGACCATTATCCCTTTTTGCGCAATGACAGGACATACTGGCTTGTCGGTCTGACGGGATC
CCTGGGTTTGTCCCTTTGTCAATGGTTGATTTGGCAAGGCGCCATGAACGTGGTACTGACTAGCCGAAACCCCAA
CATCGATCCTACAATTCTCCAGGAGCTCAGAACCTCTGGAGCTAGAGTTGAAGTATATGCCGGGTAAGTCTATCT
CTATGGAGCAAGAAACGTGGCTTCTCGAAGGAAATTGAAGCTAATAGATCACAGCGACGTGACGGACCGAGAGAG
TCTGCGGTCAGTATATGACCGCATCTGTCGGAATCTTCCCCCAATTGCTGGAGTGGCTCAGGGAGCGATGGTGCT
GCAAGACACCATGGTTAAGGACATGGACATCGAAGCTATGCAAAAGGTGTTGAAACCGAAGGTGACCGGCAGCAT
TCATCTGGATGAGTTGTTCTCCCACATCCATCCTCTAGACTTCATGATTTTCTTCTCCTCTGCAACTTGCGTCAC
AGGTAATATCGGCCAGTCCAACTACGCCGCTGCCAATATGTTCATGACCGCACTAGCAGCGAACCGCAAACAGCG
CGGGCTAGCAGGTTCTGTCATAAATATTGGAGCGATCATGGGAGTCGGCTATGTCACTCGTGAAACGAGCGAGGC
GCTGCAAAGAAATCTTCTGAAGAGTGGTCATGTGTGGATGTCAGAAGGCGACTTCCATACAATATTCGCAGAGGC
TATCCTCGCTGGGTCTCCTAGTTCCAACGCCACGGTGGAGCTCACATGTGGGCTGCGTATTATCAGAGATGTTGA
TGAGCAGCGTCCGTTATGGTCATACAGCCCGAAATTCCAGCATCTAGTCGTTCTCGACGAGTTGTCCACAGAAAC
CGATGGCGACTCCAAGAGGCAGATGCCGCTTCGACTACAGCTTCTTGAGGCAAGAACAGCTGATGAGATCTCCAA
GATTGTTCAAGGTATGTTCGAATCCACTCTGGGATACCATCGAGATACTGACTTGGTGGCAGAATCTTTCTTTGC
TAAGCTCCAGATTATGCTGGGTTTGCATGATGTGGCCAGCAGTTCTATCCTCGATAAAGCTGCAGATGAGCTTGG
AATCGATTCATTGAACACTGTCGAAATCAGATCCTGGTTCTTGAAGGAACTGAAAGTTGACATCCCGGTACTACG
CATTTTGGGAGGTGCCACCATTGACGACATTCTCCACTTCGCCTTAGATAGGCTTCCTACCGAGATGACCCCAAA
CATTGGAGCTGCTCCTGTGCCGCGGGTTGGTGAGGCTGTTGTTAGACAGCAATCTGAGATTCAATCCCGGACTTC
GGAACGGAAGCTTGGCAGTATTCCCAAGTTGGCTAGTTCTGCGGACCCTGTTGCTCGGCCAAGACCCGGTGGACC
TGGACGGACTGTCTCCTCAAAGTCTCTTTCGAATGGCCAAAGTTCATCTACGCGGGCAAGCACCACCTCCAGTCT
CGTTGATATATCCCGAGGCGAGGACACTTCATCCGGGTCCTTCAGCATCATCGAAACGCCTTCATTCAGTGAAGA
TGAGCATAATTTGCCGCTTCCGGATAACCCGAGCCAGGCCAATCTCCTGAAGCAGCCGGGCGACAGTGTCCACTC
GGCGTTACGGAAGGAGCCACTCTCCTTTGCACAATCTCGTTTCTGGTTCCTCCGCTTATACCTTGAGGATCAGAC
TACCTTTAATATCACTTGTTCATTACGAATCCAGGGCGCCTTTTCAGTTGATGCCCTTGAGCGAGCAGTTCAAGG
GGTGGGCCAACGACATGAAGCCCTAAGAACATGCTTTTCTGCGGAGGATGGAGAATCACCTACGCAAATCATCCT
GCCACACTCAACGTTGTCTCTGGAAAGGAAGACTTATCACACAATGTCTGAAGTTGAGGCTACTATGCGAGAGGT
TAAGAATCACATCTACGACCTTGAGCATGGACAGCTAATGAGGGTGCTTCTGTTGTGCCCTGCGGTGTTGGCAAC
ACCCCTGGTGCACTTCCTGATAATTGGATACCACCATATCAACATGGATGGTGTTAGCCTGGAGGTGATTCTCTC
TGAACTGCAAAACACCTACGAAGGACGTTCTCTCAGTACGCGAGTACTTCAGTACCCCGATTACGCGGCCAAACA
ACGTCAGCAGCGAAATAACGGCTCGTGGAATGAAGACTTGGCCTTCTGGAGAGAGAGATTTCCCGAACCCCCAGC
GGACTTTCCATTACTGCCTTTCGCGTGTGTATCTGACCGCCAAGCTCTGTTACGATATGGTCATCACCGAGTGCA
ACAACGCCTGAACCCAAGTCTAGGAAGACAAATCCGCCAGTTTTGCCAATCTGTCAAATGCACGCCTTCGCATTT
CTATCTTGCAGCATTCCAGGCACTGCTCTGTCGACTCGCTGAGACCCAGGATATCTGCATCGGCATGGCTGATGC
CAACCGTATTCAGGTAGAAGCAGCTGACAGCGTGGGGCCATACTTGAATCTGCTCGCCCTACCTTTGCACTATGA
TGCCAACACGCCTTTCGTTGAGTTAACTCGATCAGCTCGTAAGAAGGTCTACAGTTCTTTAGCTCACTCACAGGT
GCCATTCGATATTCTGCTATCCGAACTCAAGGTTCCGAGATCGCCATCCCATAACCCGTTGTTCCAAGTTTTCAT
GGATTATCGGCAGGATGTCCGCGAGAAACGGCAGTTCGGAGAATGTCTATTCGAAGGTCTAGATTATGAAATGGG
TCGAACATCCTACGATGTTGCTTTGGATATTGTCGACAAAGTGGAAGGCGAGCCATTGGTCATTCTTGGCCTCCA
GCAATCCCTATACAGTACCGAAGCAGCTGAGACTCTTCTGAACGCCTTTCTAAACATGGTCGCAGTCTTTGCCAA
TGATCCATCTACCCCCGTGGGCCAGGCGTCTATATTCGCTGTAAAGGATGTTCAAAGGTCCCTTGCACTCAGCCA
AGGTAAGCACGCACCCCCAAGCCTGATCTCACCACTATTAACGATGTCTTTGTATTACACAGGCCCGACAGTGCC
CAGCCGATGGCCAGCAACGCTCCCCCATCGTATTGACACGATGGTGCAACGGTTCCCCAAGAAACTTGCTTTGAA
AGACGGCCTCAACAACCGATTCACTTTTGAGGAAATGAGTCAACGAATCGACTCAATTGCGTTCGCTCTGTTAGG
CGCCAACGTCAGCCGTGGCCAACGTGTGGGTGTGTTTCAGCATCCAACGGCCGACTGGATCTGTTCTATGCTGGC
CATTCTGCGAGTGGGAGCTACTTATGTTCCGCTCGATCTTCGGCTCGAAATTCCACGTCTCAAATCGATCTGTGA
TGACTGTAAGCCTATGGTCCTTCTCGTGGACAATGAGACGAAAGATCAAGTGGACGAATTGGGGTGTTCGAACGC
ACTGTCAATGAACATCTACGATTTACCAATGTCCTTCCCTATCCCTGTCGTCAATCGTGCCGTCTTGGAAGATCC
AGCCGTGATATTTTATACTAGCGGTTCGACTGGTGCTCCCAAAGGCATTGCATTGACCCACGAGAACCTGCGCGT
CAACGTCGAAGGAAACCAGGAGGAGTTCCGACTCTGGCCGCACGATCACCTGCTGCAGCAAATTGCTTTCAGCTT
TGACTTTTCGGTATGGCAGGTGTTCATGGCGTTGGCAAACGCCGCTTCGCTTTTCATTGCCCCGCTGTCTAAACG
TGGTGATCCGGTGGCCTTGGTGGAATCGATTCTTACGGAGGGTATCACCGTCGCAGGGGCCACTCCTTCCGAATA
TCACAGTTGGTTTATGCACGGTGATTTGTCGGGTCTCAAGAAGTCCAAATGGAGGACTGCGGTCAGTGCAGGGGA
GCCGATGACTTCGAGCATGATTCATGATTTCCAAGAGTTGAACAAGCGGGATCTTCGACTTTTCAACGGGTACGG
CCCAACCGAAGCCAGCATGTCTTCCAACAAACTGCAAGTGCCGTACCTCCGCAGCAAAACCCAGAGTCCACAGGA
GTGGATGCACCGTGGGTCGGTCGTCGCCGGATACACGGCCCCGAATTACTCCATCTACATAGTCGACGAAGCGCT
CAACCCCGTTCCCGTTGGTATTCCAGGCCAGATACTTATTGGTGGTCCTGGGATCGCGCATGGGTACTTGAACAA
CGAGGATCTATCACGCAGTCGCTTCATGGAGGACCGATTCGCCACGGCCGAACAAAAGGCTCAAGGATGGCGACG
GGTTCACCTCACCGGCGATCGCGGGCGAATCCGGCCAGACGGACAACTTCAAATCGAGGGTCGGATTAACGGGGA
CACCCAGGTGAAGTTGCGCGGCTACCGCGTCGACTTGCGCGATATCGAAACGGTGATCCTTCAATCATCGCAAGG
GATGCTTAAGGAGGCCGTCGTCACTCTCTATACAGGCTCCAATACCAACACGGAACTGCTGGTCGCTTATGTGAT
TTTCCTTGCCGGATATCCTGTGGAGCAACGCAAGCAATCCTTGCGGGAACTTAGCAAATCTCTGCCTCTGCCTCG
TTACATGTGGCCGTCCATGGTGCTCCCCGTGGATGACATGCCAGTCACAGCCCACGGCAAGCTTGACCGCAAGGC
CTTGAGCACTCGAAGCCTTCCGCAGACCGAGGCAGAATCGGTGGGTCTCACCTCGCAGCTCACGGGAACAGAAGC
CCGGCTTGTCGAGCTTTGGCGGTCGGTCATCTCGAAGGATGTTATCGCCATCCATGGACTAGAGCCCGAGTCCGA
CTTTTTCGCGGTTGGAGGCAACTCCATGCTGCTCGTGGAGTTGCAGCGGCAGATCAAAGTGGAGTTCCGCACGGA
AATTCCGCTAGTGCAGCTATTCGGAGCGACCACGGTGCAGAAGATGGCTCTCCTCCTCGACCCGTCGACCGATGC
GGCGAAAATTGCCGCTGGTCCCGTTGCTACAACGGCAGCAGCGCCCATCATTTGGGAGCAGGAAATTCAGCTTCC
CGACCAGCTTCAGCTGTCAACACCGATGGCCCCTACAACTCGATTAGAGAATCTGAAAGGGCTCTGCATTGTGCT
CACCGGTGCCACTGGATTTATCGGGCGAGCTCTCCTCCAGCGGCTGGTGGAAGACCCGGCCGTAGCCACCGTTCA
CTGCATTGCCGTCCGGGTTACGAGCACTCGGCGCCCTCCTCTGGTCACCGCAGGCAAGATTATTGTGCACTACGG
GGATCTTACGCTGCCGAGGTTGGGACTTGTAGAAGCCCAAGCCACCGCGATCTTCAATGATGCTGACGCGGTGAT
CCACAACGGAGCCGATGTCAGCTTCCTCAAGAATTATCCGGCCCTTCGTCGAGCCAACGTGGATTCGACCATCGA
GTTGCTCCAGCTGGCGTGGCCGCGCCAGGTGCCAGTCCACTACGTTTCCACCAGCGGCGTCGCCAATTTCACCCA
ATCCTCGACTTTCGCAGAGGTCTCCGCTGCCAGCGTCCTACCTCCGACCGATGGATCCCAGGGATACTTGAGTTC
CAAGTGGGCCAGCGAGCGCGTGCTCGAAGAGGCGAACCGGAAAGCGGACTTCCCCGTCTGGATACATCGCCCTTC
CAGCGTCACTGGCGAGGGATCATCCCCCTTGGACTTGATGGACAATCTCCTCGAGTTCTCTAGGAAACTACGTGC
GGTTCCTCTCCCCGCGAAGTCCTCGTGGCAGGGCTATCTCGACTTTGTGCCTGTGGAACAGGTGGCTCGGGATAT
TGTACGCGAGATTCTGGCACCTCGGGATCCCTCTCCCTTGAATCAGGTACGGTACCTTCACCATCTTGGGGAGCA
GATCCCACTACATGGAATACAACGATACTTGGAGAAGGGTACGGGTGCATCGTATCGGGCATTACCCATGGGGGA
GTGGTTGAAGGAGGCCCAGCAGGCAGGCCTCAGTGCACTGTTGGTCGAGTATCTTGGTCAGATGGATAGACCTGA
CGTCAAAGTGGTGTTCCCACGGTTGGTGGCACGTCCACGACTTACATCGGGAGGGCTGACGCGGCAAGGTTCTTG
GGTGTCTAAGGGGGTAGCTATGTTGCTGACGTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail