Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2029.t1
Gene name
Locationscaffold_02:1467489..1469463
Strand-
Gene length (bp)1974
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.8E-39 48 449
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 4.0E-19 35 336
PF00083 Sugar_tr Sugar (and other) transporter 1.0E-10 97 217

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.5

Transmembrane Domains

Domain # Start End Length
1 41 63 22
2 83 105 22
3 112 134 22
4 139 161 22
5 168 190 22
6 195 217 22
7 237 259 22
8 264 286 22
9 307 329 22
10 344 363 19
11 370 389 19
12 404 426 22
13 438 457 19
14 514 531 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 24.41 13.48 35.34
5d_25C Five days - 25 degrees Celsius 46.35 27.77 64.94
7d_25C Seven days - 25 degrees Celsius 56.98 34.61 79.36
10d_25C Ten days - 25 degrees Celsius 85.57 52.44 118.70
7d_15C Seven days - 15 degrees Celsius 48.28 27.45 69.11
7d_30C Seven days - 30 degrees Celsius 82.63 50.50 114.75

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.003197 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.002297 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.410867 no
5d_25C 7d_15C 0.908978 no
5d_25C 7d_30C 0.005626 yes
5d_25C 10d_25C 0.003197 yes
7d_25C 7d_15C 0.551959 no
7d_25C 7d_30C 0.080774 no
7d_25C 10d_25C 0.045367 yes
7d_15C 7d_30C 0.010735 yes
7d_15C 10d_25C 0.005626 yes
7d_30C 10d_25C 0.916708 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2029.t1
MTPEQTGPGQNQHADGEPGSGPTNPPKSAAAAATFKKGPRFYAILVAICFVGMMTALEGTITSTALPSIIADLGG
GDRYVWAVNGYFLAMTALQPLQGQLANVFGRRWPTIISTATFILGSGIGGGASNMSMLIAGRVIQGVGAGGINVL
IEIIVCDLIPLRQRGQYIGMIFGVIALGTALGPLFGGLIVQHTTWRWVFYLNLPIGGVALVILILFLHVKYNQEK
TFADKLTQIDWLGNVLFVATISAILIALSWAGAVYPWSSYHVIVPLVIGMLGLVGFMLFEASPRLAPHPMMPLHL
FSNRTSAIAFILTFLHGIITIWALFFLPVYFQGVLGSSTTRSGIQLLPTILALVPFAGLGGTLMSKLGQYRFIHG
AGFALVIIGFGLLTLLDERSNTGSWVGFQIIQSAGAGLVIPTLLPAVLAPLTEADTALATATWSFLRTFGMMWGT
AIPAAVLNNRFDSLAPGRIGDQRVRTELLGGQAYEHATAAFRNTLPSETLKQFVSVLSDSIKRTWQVAIAFAALG
LLVVLLEKDVPLRQELDTEFGLDEKGKSENAKDSEAGVDTSLVVEKKE*
Coding >Pro_DTO377G3_2|g2029.t1
ATGACACCGGAACAGACAGGTCCAGGCCAAAACCAACATGCTGACGGGGAGCCGGGCAGTGGCCCCACGAACCCA
CCCAAGTCCGCGGCTGCTGCCGCTACCTTCAAGAAAGGGCCCCGTTTCTATGCCATCCTCGTCGCCATTTGCTTT
GTGGGCATGATGACTGCCCTGGAGGGCACCATCACCTCCACCGCACTGCCTTCAATCATCGCAGATTTGGGCGGA
GGTGACCGCTATGTCTGGGCCGTGAACGGCTATTTTCTTGCCATGACCGCCTTGCAACCGCTGCAGGGACAGCTG
GCCAATGTATTCGGACGACGCTGGCCCACCATCATTTCCACCGCCACCTTCATCTTGGGCAGCGGAATCGGCGGC
GGCGCGAGCAATATGTCAATGCTAATAGCAGGACGCGTGATCCAGGGTGTGGGTGCCGGAGGAATCAACGTCCTC
ATTGAGATCATTGTCTGTGACTTGATCCCGTTACGTCAACGAGGGCAATACATTGGTATGATCTTCGGCGTCATT
GCGCTCGGCACGGCCTTGGGCCCCTTATTCGGCGGCCTCATTGTCCAACACACCACCTGGCGTTGGGTGTTTTAT
CTGAACCTGCCGATTGGTGGCGTGGCGTTGGTGATCCTGATCCTGTTCCTTCATGTGAAGTACAATCAGGAAAAG
ACCTTTGCGGATAAGCTAACGCAGATCGATTGGTTGGGCAACGTGCTTTTTGTGGCGACCATAAGCGCTATTCTT
ATCGCGCTCTCCTGGGCCGGCGCCGTGTATCCGTGGTCGTCCTACCACGTTATTGTGCCTTTGGTCATCGGCATG
CTGGGTTTAGTGGGCTTCATGTTGTTTGAAGCGTCGCCGCGACTCGCTCCCCATCCAATGATGCCCCTCCATCTC
TTTTCGAACCGGACGTCCGCGATAGCGTTCATTCTGACCTTCCTACACGGGATCATCACAATCTGGGCACTCTTC
TTCCTACCCGTTTACTTCCAAGGGGTCCTGGGTTCATCGACCACCCGATCTGGTATTCAGTTGTTGCCGACCATT
CTGGCGCTAGTACCGTTTGCTGGCCTAGGGGGAACCCTGATGTCGAAGCTAGGTCAATATCGGTTCATCCATGGT
GCTGGTTTTGCTTTGGTGATTATCGGCTTCGGACTGTTGACTCTGCTAGACGAGCGCTCCAACACAGGCAGTTGG
GTAGGATTTCAGATCATACAGTCTGCTGGTGCGGGTCTAGTCATTCCCACGTTACTTCCTGCCGTCCTGGCACCA
TTGACAGAAGCTGACACCGCGCTGGCCACTGCAACTTGGTCATTCCTGCGAACCTTTGGCATGATGTGGGGAACG
GCCATTCCAGCAGCCGTCTTGAACAATCGCTTCGATAGCCTTGCTCCCGGACGCATCGGAGACCAGCGAGTTCGT
ACCGAGCTTCTCGGCGGACAAGCATACGAGCATGCTACCGCCGCGTTTCGTAACACTTTGCCGTCAGAAACCCTG
AAGCAGTTCGTTTCAGTTCTGTCAGATAGCATCAAGAGGACTTGGCAAGTGGCCATTGCCTTTGCAGCTTTGGGG
TTACTGGTTGTGCTCTTGGAAAAGGATGTTCCTTTGCGTCAAGAGTTGGACACTGAGTTCGGACTGGACGAGAAG
GGCAAGTCTGAGAATGCCAAGGATTCTGAAGCGGGTGTGGATACATCTTTGGTCGTAGAAAAGAAAGAATGA
Transcript >Pro_DTO377G3_2|g2029.t1
ATGACACCGGAACAGACAGGTCCAGGCCAAAACCAACATGCTGACGGGGAGCCGGGCAGTGGCCCCACGAACCCA
CCCAAGTCCGCGGCTGCTGCCGCTACCTTCAAGAAAGGGCCCCGTTTCTATGCCATCCTCGTCGCCATTTGCTTT
GTGGGCATGATGACTGCCCTGGAGGGCACCATCACCTCCACCGCACTGCCTTCAATCATCGCAGATTTGGGCGGA
GGTGACCGCTATGTCTGGGCCGTGAACGGCTATTTTCTTGCCATGACCGCCTTGCAACCGCTGCAGGGACAGCTG
GCCAATGTATTCGGACGACGCTGGCCCACCATCATTTCCACCGCCACCTTCATCTTGGGCAGCGGAATCGGCGGC
GGCGCGAGCAATATGTCAATGCTAATAGCAGGACGCGTGATCCAGGGTGTGGGTGCCGGAGGAATCAACGTCCTC
ATTGAGATCATTGTCTGTGACTTGATCCCGTTACGTCAACGAGGGCAATACATTGGTATGATCTTCGGCGTCATT
GCGCTCGGCACGGCCTTGGGCCCCTTATTCGGCGGCCTCATTGTCCAACACACCACCTGGCGTTGGGTGTTTTAT
CTGAACCTGCCGATTGGTGGCGTGGCGTTGGTGATCCTGATCCTGTTCCTTCATGTGAAGTACAATCAGGAAAAG
ACCTTTGCGGATAAGCTAACGCAGATCGATTGGTTGGGCAACGTGCTTTTTGTGGCGACCATAAGCGCTATTCTT
ATCGCGCTCTCCTGGGCCGGCGCCGTGTATCCGTGGTCGTCCTACCACGTTATTGTGCCTTTGGTCATCGGCATG
CTGGGTTTAGTGGGCTTCATGTTGTTTGAAGCGTCGCCGCGACTCGCTCCCCATCCAATGATGCCCCTCCATCTC
TTTTCGAACCGGACGTCCGCGATAGCGTTCATTCTGACCTTCCTACACGGGATCATCACAATCTGGGCACTCTTC
TTCCTACCCGTTTACTTCCAAGGGGTCCTGGGTTCATCGACCACCCGATCTGGTATTCAGTTGTTGCCGACCATT
CTGGCGCTAGTACCGTTTGCTGGCCTAGGGGGAACCCTGATGTCGAAGCTAGGTCAATATCGGTTCATCCATGGT
GCTGGTTTTGCTTTGGTGATTATCGGCTTCGGACTGTTGACTCTGCTAGACGAGCGCTCCAACACAGGCAGTTGG
GTAGGATTTCAGATCATACAGTCTGCTGGTGCGGGTCTAGTCATTCCCACGTTACTTCCTGCCGTCCTGGCACCA
TTGACAGAAGCTGACACCGCGCTGGCCACTGCAACTTGGTCATTCCTGCGAACCTTTGGCATGATGTGGGGAACG
GCCATTCCAGCAGCCGTCTTGAACAATCGCTTCGATAGCCTTGCTCCCGGACGCATCGGAGACCAGCGAGTTCGT
ACCGAGCTTCTCGGCGGACAAGCATACGAGCATGCTACCGCCGCGTTTCGTAACACTTTGCCGTCAGAAACCCTG
AAGCAGTTCGTTTCAGTTCTGTCAGATAGCATCAAGAGGACTTGGCAAGTGGCCATTGCCTTTGCAGCTTTGGGG
TTACTGGTTGTGCTCTTGGAAAAGGATGTTCCTTTGCGTCAAGAGTTGGACACTGAGTTCGGACTGGACGAGAAG
GGCAAGTCTGAGAATGCCAAGGATTCTGAAGCGGGTGTGGATACATCTTTGGTCGTAGAAAAGAAAGAATGA
Gene >Pro_DTO377G3_2|g2029.t1
ATGACACCGGAACAGACAGGTCCAGGCCAAAACCAACATGCTGACGGGGAGCCGGGCAGTGGCCCCACGAACCCA
CCCAAGTCCGCGGCTGCTGCCGCTACCTTCAAGAAAGGGCCCCGTTTCTATGCCATCCTCGTCGCCATTTGCTTT
GTGGGCATGATGACTGCCCTGGAGGGCACCATCACCTCCACCGCACTGCCTTCAATCATCGCAGATTTGGGCGGA
GGTGACCGCTATGTCTGGGCCGTGAACGGCTATTTTCTTGCCATGTATGTACCGCGACCAATGCCCACCCCCTGA
TTCCCCGTCCGAGGCGCGCTGACGAACCAACCCACCATCAGGACCGCCTTGCAACCGCTGCAGGGACAGCTGGCC
AATGTATTCGGACGACGCTGGCCCACCATCATTTCCACCGCCACCTTCATCTTGGGCAGCGGAATCGGCGGCGGC
GCGAGCAATATGTCAATGCTAATAGCAGGACGCGTGATCCAGGGTGTGGGTGCCGGAGGAATCAACGTCCTCATT
GAGATCATTGTCTGTGACTTGATCCCGTTACGTCAACGAGGGCAATACATTGGTATGATCTTCGGCGTCATTGCG
CTCGGCACGGCCTTGGGCCCCTTATTCGGCGGCCTCATTGTCCAACACACCACCTGGCGTTGGGTGTTTTATCTG
AACCTGCCGATTGGTGGCGTGGCGTTGGTGATCCTGATCCTGTTCCTTCATGTGAAGTACAATCAGGAAAAGACC
TTTGCGGATAAGCTAACGCAGATCGATTGGTTGGGCAACGTGCTTTTTGTGGCGACCATAAGCGCTATTGTACGT
CTGATTTTGATTTTGTTTCATTCATGATCTTCCCGCTGGGGCCTTGATGGCTAATTGGCATAGCTTATCGCGCTC
TCCTGGGCCGGCGCCGTGTATCCGTGGTCGTCCTACCACGTTATTGTGCCTTTGGTCATCGGCATGCTGGGTTTA
GTGGGCTTCATGTTGTTTGAAGCGTCGCCGCGACTCGCTCCCCATCCAATGATGCCCCTCCATCTCTTTTCGAAC
CGGACGTCCGCGATAGCGTTCATTCTGACCTTCCTACACGGGATCATCACAATCTGGGCACTCTTCTTCCTACCC
GTTTACTTCCAAGGGGTCCTGGGTTCATCGACCACCCGATCTGGTATTCAGTTGTTGCCGACCATTCTGGCGCTA
GTACCGTTTGCTGGCCTAGGGGGAACCCTGATGTCGAAGCTAGGTCAATATCGGTTCATCCATGGTGCTGGTTTT
GCTTTGGTGATTATCGGCTTCGGACTGTTGACTCTGCTAGACGAGCGCTCCAACACAGGCAGTTGGGTAGGATTT
CAGATCATACAGTCTGCTGGTGCGGGTCTAGGTATGGACCATTCGATTTGCCCCTTTTTGTCTTCTGCTCACCCC
TCCATATAGTCATTCCCACGTTACTTCCTGCCGTCCTGGCACCATTGACAGAAGCTGACACCGCGCTGGCCACTG
CAACTTGGTCATTCCTGCGAACCTTTGGCATGATGGTACGAGACCTCAGACCCTGCAAACGAGACTCAATACTAA
TCCAAACATTGTGTGCAGTGGGGAACGGCCATTCCAGCAGCCGTCTTGAACAATCGCTTCGATAGCCTTGCTCCC
GGACGCATCGGAGACCAGCGAGTTCGTACCGAGCTTCTCGGCGGACAAGCATACGAGCATGCTACCGCCGCGTTT
CGTAACACTTTGCCGTCAGAAACCCTGAAGCAGTTCGTTTCAGTTCTGTCAGATAGCATCAAGAGGACTTGGCAA
GTGGCCATTGCCTTTGCAGCTTTGGGGTTACTGGTTGTGCTCTTGGAAAAGGATGTTCCTTTGCGTCAAGAGTTG
GACACTGAGTTCGGACTGGACGAGAAGGGCAAGTCTGAGAATGCCAAGGATTCTGAAGCGGGTGTGGATACATCT
TTGGTCGTAGAAAAGAAAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail