Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2005.t1
Gene name
Locationscaffold_02:1397902..1403503
Strand+
Gene length (bp)5601
Transcript length (bp)5439
Coding sequence length (bp)5439
Protein length (aa) 1813

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18378 Nup188_C Nuclear pore protein NUP188 C-terminal domain 5.0E-141 1439 1807
PF10487 Nup188 Nucleoporin subcomplex protein binding to Pom34 7.2E-78 103 1140

GO

GO Term Description Terminal node
GO:0017056 structural constituent of nuclear pore Yes
GO:0003674 molecular_function No
GO:0005198 structural molecule activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2005.t1
MAPVPEAYFPSLDKCFSGDVQLLSWKRAFLYAIDPESHANDGGNIDVFFSHSESIRLLSDGLKPPPSPSAKSKSE
FESKTAAIHVETNGQSSFDLKEIKADTLWLSKQAGIDEISALRIAILEWQNRPAARLTIGFSSEEATSLQSAAGT
ENLRGSLAGPSFANLLNQTARSDGGQSFEKEEKRRLRLREVYLSEETHVVKTLRKLLALSLHDGISADSTASHDR
KLALQKVGTTIFQDKSTGDGLDRFLQECISSIRRRLTSLEGDGGWLGATESSEEIENIWRTSLVEEIVHIVQIMF
HQLQASVEFPSADLLLSWLQLMADYSFLETIQAPCQQPVEVLLPLQAFVSLTTLAFLKPARAISFLQNEEYMQSS
LQPYFCCKDKISQINEIFLTACGDLNTVNPAAFSWGLILYTIQELAEDRRTSRERQLSHALAAAYDEQTQNEALA
QASVSSDYEQLLDCARTPQSTAEDAIPILTSDFLKESAFNTVIALASKTGSMSAVDDGLTTRWIRLSLLDLIRVA
IMFLDYSPEIVGSVLAILNDDDNGLSRDSNSLGPASDPKSVFAKDQNLMDGIFRIARSRFPYETSPFLLLCRALV
SGHSLNEEGLPAILEEVETMESFTQIVPPTFQGYATIREDENADFVSLLQPLPMLETSIQNRAFEREPSNAVIVS
GSSEIPRLTVGQVISDSKPAVIMWEHRYSCLSFLGSWLEEWSETGGHSSEWTDDTAAEIIALLADLIANSKSQSS
GDASGKRILEMASDGLSKQGDIISVIFDIFERNLQTIGSRGDLGKSLDVTMACLRFIKALIKILPSRVWPFLGRS
SLIGSDGKGGIMTAIVSAMEVPSGEYPFLLSCVDLVGAVIDDAASRAVLRKSPGSVTSKPSIASDWSAGIPSHVM
RTIMLNFIRTMLEIFNSCGNWRFNLPEQRLKINSMLATSFERVLYYAFGINDSPKLETKVTGVFSTSAAYILDML
RPRSTADLPFNPILRLIAEGLQTPPTLHLRYLILFEDQVNSTLRLCIKLVQAAQLAEQPASLLEEQLFKASPVLV
KLYALHDAYRLPVVSLLEILISSAASNPDNEPPSLVGHLGAESSCLFLDVLSQLDKPMCDRPLFLAVWQLLSTFV
SKRQQWLAVFILTGSSPRQTLKKEPTSSGLSMRSVPFLKLALEKLSHIDQQEPQVALALLEFVSRAQENWPWATS
HLSKHPQFFNSIINHVSKLKISSLPVMDQIYATRIAAVVADLCAVYLHSAKEMGDRSFIKTLIPLVSWYAKDAVE
VSAYNSSLHANLKKNFEMRYAGCKIVDFKRTPLEVRHLGRDYYYDMSMGDKLLSYDFAWAGTKNRGFAEEFERAN
INLSLVEAQVSLLHSWKFFAIEHCADFMPDTEVRKSMALVAQSCLKANISSGPPEAIFERIQQARVDFAQALLQR
LVEVHARGAEVFQLLEITWNALRSRHLTYEDALINDDTDYFRSLLNVLFLSLQFHLDGPSRSAPEAINKRAEVSS
GLTVIVEVVKTIVAQGFKSLTTYLHDAPEKCTPKDFAIINAILQTCLQVKNADRLYEHIVYHIEEYDTARHATTL
FSWADQLAVAGDPVYAELSISILVKMSTLPMLAEHLAVDAVLMKLSTCRLTNILCQKKAFGPFDPVPRLYAIWTG
GFLPLCLNMLYSVMRAAPEVAAFLNQFESRLTRATEAFSSHTAVSSVPTSKWISLNMVSEAYSLALISFILDRFR
EAGASAGVDAQAIQDLKWDRVQVKEDIEELLGRRAALRARIVATNEKELEWSRQKPVDPTSESQNRLEEKLVSEL
KATVTCLSGEDS*
Coding >Pro_DTO377G3_2|g2005.t1
ATGGCTCCCGTCCCGGAGGCCTATTTCCCGTCCCTGGACAAGTGCTTCTCCGGGGACGTTCAACTCTTGTCATGG
AAAAGAGCTTTTCTCTACGCCATTGATCCCGAAAGTCATGCTAATGATGGAGGCAATATCGATGTCTTCTTCTCA
CACTCCGAATCCATTCGCCTACTCTCTGATGGCCTAAAACCGCCCCCCTCCCCCTCCGCAAAATCCAAGTCGGAA
TTCGAATCCAAAACCGCAGCAATCCATGTTGAGACCAATGGCCAAAGTTCTTTCGACCTGAAGGAGATCAAGGCG
GACACGCTATGGTTAAGCAAGCAAGCCGGAATCGACGAGATTTCTGCTCTTCGCATCGCTATCTTAGAATGGCAG
AACCGCCCGGCAGCGCGTCTCACCATCGGTTTTTCCAGCGAGGAAGCGACCAGTCTACAGAGTGCGGCTGGGACC
GAGAATCTTCGAGGCTCTCTAGCCGGTCCCAGCTTCGCCAACCTATTGAACCAAACAGCCAGAAGCGACGGTGGT
CAATCATTTGAAAAAGAGGAGAAGAGGCGCTTGCGACTCCGCGAGGTGTATCTCTCCGAGGAAACCCATGTCGTA
AAAACACTCCGCAAGCTGCTTGCTCTGTCCCTACACGATGGTATCTCAGCCGACTCGACCGCCAGTCATGATCGC
AAACTTGCTTTGCAGAAGGTAGGGACCACAATTTTCCAGGACAAGTCGACTGGTGATGGATTGGACCGGTTTCTT
CAAGAATGCATCAGCTCGATACGTCGTCGGTTAACGAGTTTGGAAGGAGACGGTGGCTGGCTCGGTGCCACAGAA
AGCAGTGAGGAAATAGAGAACATATGGAGAACAAGTCTCGTGGAGGAGATTGTTCATATCGTGCAAATCATGTTT
CACCAGCTTCAAGCATCGGTGGAATTTCCAAGTGCAGACCTCCTATTGTCCTGGCTCCAGCTCATGGCTGATTAT
AGCTTCCTGGAGACAATTCAAGCGCCTTGTCAGCAACCCGTGGAAGTGTTGTTGCCCCTTCAAGCTTTCGTGTCA
CTTACCACATTGGCGTTTTTAAAACCCGCTCGCGCCATCTCTTTCCTTCAGAATGAGGAATACATGCAATCCTCG
CTCCAGCCTTACTTCTGCTGTAAGGATAAAATCTCTCAAATCAATGAGATTTTCCTTACTGCATGCGGTGATTTG
AACACCGTGAATCCGGCAGCCTTTTCATGGGGCCTGATCTTGTATACCATCCAAGAGCTGGCAGAAGACAGAAGA
ACCAGCCGAGAGCGTCAATTGAGCCATGCTTTGGCTGCCGCCTACGACGAGCAGACACAGAATGAAGCACTAGCT
CAAGCATCTGTGTCTTCAGATTATGAACAATTGCTTGACTGCGCTAGGACTCCGCAAAGCACGGCGGAAGATGCT
ATTCCCATTCTTACATCTGATTTCCTGAAAGAATCGGCATTCAACACCGTTATCGCCCTGGCTAGTAAGACCGGG
TCAATGTCAGCCGTCGATGATGGCCTGACAACCCGATGGATTCGGTTATCACTTCTCGACCTTATCCGAGTCGCT
ATTATGTTCTTGGATTACTCTCCCGAAATTGTGGGGTCAGTCCTGGCTATCTTAAATGATGATGACAACGGGCTG
TCAAGAGACTCAAATTCCCTAGGTCCTGCCAGCGATCCTAAGTCTGTATTCGCCAAGGATCAGAATTTGATGGAT
GGCATCTTTCGCATTGCACGGTCCCGTTTCCCTTATGAAACGTCACCATTTTTACTGCTCTGTCGTGCTCTCGTC
AGTGGGCACTCTTTGAATGAAGAAGGTTTGCCGGCTATTCTTGAGGAGGTGGAAACTATGGAATCCTTTACACAG
ATTGTCCCACCCACTTTCCAGGGCTATGCCACCATTCGAGAAGACGAGAACGCCGATTTTGTTTCCCTGCTCCAA
CCCCTCCCAATGTTAGAAACATCGATCCAGAACCGTGCTTTCGAGAGGGAACCAAGCAATGCTGTAATCGTCAGC
GGTTCTTCCGAAATTCCACGGCTGACCGTTGGTCAAGTCATTTCCGATTCAAAACCCGCGGTTATCATGTGGGAG
CATCGATACTCCTGCTTAAGCTTTCTAGGAAGCTGGCTTGAAGAATGGAGCGAGACCGGTGGGCACTCGTCTGAG
TGGACTGATGACACTGCTGCGGAAATTATTGCTCTCTTGGCCGACTTGATAGCCAACTCTAAATCACAAAGCTCT
GGCGATGCAAGCGGCAAAAGGATTCTAGAGATGGCTAGTGATGGGCTGTCCAAACAGGGTGACATCATTTCTGTG
ATCTTCGATATCTTTGAACGCAATTTGCAGACTATCGGCTCCCGAGGAGACTTGGGCAAGTCTTTGGACGTAACC
ATGGCATGTCTGCGCTTTATCAAGGCACTTATAAAGATTTTACCCAGTCGAGTATGGCCTTTCCTTGGTCGCAGC
AGTCTCATCGGGTCCGATGGCAAGGGAGGCATCATGACAGCAATCGTTTCAGCAATGGAAGTTCCTTCCGGCGAG
TATCCGTTCCTCCTCAGTTGTGTTGACCTTGTGGGCGCTGTCATCGATGATGCGGCATCTCGAGCAGTATTGCGA
AAGAGCCCGGGCAGCGTGACAAGCAAACCATCTATCGCATCTGATTGGAGTGCTGGTATTCCATCTCACGTCATG
AGAACTATTATGTTGAACTTTATTCGCACAATGCTGGAGATTTTCAACAGCTGTGGAAATTGGAGGTTCAACCTA
CCAGAACAACGGCTCAAGATCAACTCGATGCTTGCTACTTCGTTCGAGCGTGTTCTGTACTATGCCTTCGGAATC
AATGACAGCCCGAAACTAGAGACCAAAGTGACCGGCGTTTTCTCTACATCTGCGGCGTACATTCTGGATATGCTG
CGCCCTCGGTCAACCGCCGACCTGCCCTTCAACCCAATTCTTCGGTTGATCGCTGAGGGTCTTCAGACTCCCCCA
ACACTTCATCTCAGATATCTTATCCTCTTTGAAGATCAGGTCAACTCTACACTGCGGCTCTGCATCAAACTTGTA
CAGGCAGCCCAACTGGCAGAACAACCTGCCTCGCTTCTGGAGGAACAACTATTCAAAGCCAGCCCGGTCTTAGTC
AAACTCTACGCGCTACATGATGCATACAGATTGCCGGTTGTGTCGCTTCTCGAGATTTTGATCTCAAGCGCCGCT
TCAAATCCGGATAATGAACCACCTTCCCTTGTTGGCCACCTTGGGGCAGAGTCGTCCTGTCTGTTCCTTGATGTA
CTGTCACAACTCGACAAGCCGATGTGTGACAGACCTCTATTTCTTGCAGTATGGCAGCTGCTATCGACATTTGTT
AGCAAGCGTCAGCAGTGGCTTGCAGTTTTCATTCTCACAGGGTCATCCCCTCGGCAGACTCTGAAGAAGGAACCC
ACTTCTAGTGGGCTTAGCATGAGGAGCGTGCCTTTCCTGAAACTGGCGCTTGAGAAATTGTCTCATATTGATCAA
CAAGAGCCGCAAGTAGCCTTAGCGTTGCTCGAGTTTGTCTCTCGTGCCCAAGAAAATTGGCCATGGGCCACTTCC
CACCTGAGCAAGCACCCCCAGTTCTTCAACAGCATAATTAACCACGTCTCAAAATTGAAGATCTCTTCTCTGCCA
GTGATGGACCAAATCTATGCCACGCGGATTGCAGCTGTTGTCGCGGACCTGTGCGCGGTCTATCTGCACTCGGCA
AAGGAAATGGGAGACCGAAGCTTTATAAAGACCTTGATTCCATTAGTTTCGTGGTATGCCAAGGATGCAGTTGAA
GTTTCGGCTTACAATTCTTCATTGCACGCCAACTTGAAAAAGAACTTTGAGATGCGATACGCGGGCTGCAAAATT
GTGGACTTCAAAAGGACACCGCTCGAAGTTCGTCATCTGGGACGGGATTACTACTACGACATGAGTATGGGAGAC
AAACTGCTGTCCTACGACTTTGCCTGGGCTGGCACCAAGAACCGTGGGTTTGCCGAGGAGTTTGAGCGTGCCAAC
ATCAATCTGTCTCTTGTCGAGGCGCAGGTGAGCCTTCTCCATAGCTGGAAGTTCTTCGCTATCGAGCATTGTGCC
GATTTCATGCCCGATACCGAAGTCCGAAAGTCTATGGCACTGGTCGCGCAAAGTTGTTTGAAGGCCAATATTAGC
AGTGGCCCTCCCGAGGCCATCTTTGAGCGAATCCAACAAGCACGCGTTGACTTTGCCCAGGCACTTCTCCAGCGG
CTTGTCGAGGTACATGCTAGAGGCGCCGAAGTCTTCCAGCTGCTCGAGATTACCTGGAACGCACTGCGATCCCGC
CATCTGACATATGAAGACGCTTTGATCAATGATGATACCGATTACTTCCGGTCCCTACTGAACGTGTTGTTCCTT
TCCCTTCAGTTTCACCTTGATGGCCCCTCCCGGAGTGCCCCCGAAGCTATCAATAAGAGGGCTGAGGTTTCTTCG
GGTCTGACTGTCATCGTGGAAGTCGTGAAAACAATAGTGGCCCAGGGCTTCAAATCCCTCACTACTTATCTCCAT
GATGCGCCCGAGAAATGCACGCCAAAAGATTTCGCCATTATCAATGCTATTCTACAGACATGCTTGCAAGTGAAG
AACGCTGATCGTCTCTATGAGCACATCGTGTACCACATTGAGGAATACGACACCGCTCGTCATGCGACGACGCTC
TTCTCCTGGGCCGACCAATTGGCCGTTGCCGGCGACCCTGTGTACGCCGAGCTCAGCATCTCGATTCTGGTCAAA
ATGTCAACCCTGCCCATGCTCGCAGAGCACCTTGCTGTTGATGCTGTCTTGATGAAACTGTCCACCTGCCGTCTT
ACAAACATTCTCTGCCAAAAGAAAGCATTCGGACCCTTTGATCCTGTTCCCCGACTGTATGCCATCTGGACTGGT
GGCTTCCTTCCTCTGTGTCTGAATATGCTCTACAGTGTGATGCGGGCCGCGCCGGAGGTGGCAGCATTCCTGAAC
CAGTTTGAATCTCGCCTGACCCGCGCGACAGAGGCATTCTCCAGCCATACGGCCGTTTCCTCGGTTCCGACATCC
AAGTGGATTAGCCTCAACATGGTCTCGGAAGCCTACTCGCTTGCGCTGATTTCGTTCATCCTGGACCGGTTCCGC
GAGGCGGGTGCCAGTGCTGGAGTTGACGCACAGGCCATCCAAGATCTCAAATGGGATAGGGTGCAGGTCAAGGAA
GATATTGAGGAACTGCTCGGTCGCCGCGCTGCTCTGCGTGCACGCATTGTCGCGACCAATGAAAAGGAGCTGGAA
TGGTCCCGACAGAAGCCTGTCGACCCGACTTCTGAGTCACAGAACCGATTAGAGGAGAAGCTTGTTAGTGAGCTG
AAGGCAACAGTGACGTGTTTGAGTGGGGAGGATTCATGA
Transcript >Pro_DTO377G3_2|g2005.t1
ATGGCTCCCGTCCCGGAGGCCTATTTCCCGTCCCTGGACAAGTGCTTCTCCGGGGACGTTCAACTCTTGTCATGG
AAAAGAGCTTTTCTCTACGCCATTGATCCCGAAAGTCATGCTAATGATGGAGGCAATATCGATGTCTTCTTCTCA
CACTCCGAATCCATTCGCCTACTCTCTGATGGCCTAAAACCGCCCCCCTCCCCCTCCGCAAAATCCAAGTCGGAA
TTCGAATCCAAAACCGCAGCAATCCATGTTGAGACCAATGGCCAAAGTTCTTTCGACCTGAAGGAGATCAAGGCG
GACACGCTATGGTTAAGCAAGCAAGCCGGAATCGACGAGATTTCTGCTCTTCGCATCGCTATCTTAGAATGGCAG
AACCGCCCGGCAGCGCGTCTCACCATCGGTTTTTCCAGCGAGGAAGCGACCAGTCTACAGAGTGCGGCTGGGACC
GAGAATCTTCGAGGCTCTCTAGCCGGTCCCAGCTTCGCCAACCTATTGAACCAAACAGCCAGAAGCGACGGTGGT
CAATCATTTGAAAAAGAGGAGAAGAGGCGCTTGCGACTCCGCGAGGTGTATCTCTCCGAGGAAACCCATGTCGTA
AAAACACTCCGCAAGCTGCTTGCTCTGTCCCTACACGATGGTATCTCAGCCGACTCGACCGCCAGTCATGATCGC
AAACTTGCTTTGCAGAAGGTAGGGACCACAATTTTCCAGGACAAGTCGACTGGTGATGGATTGGACCGGTTTCTT
CAAGAATGCATCAGCTCGATACGTCGTCGGTTAACGAGTTTGGAAGGAGACGGTGGCTGGCTCGGTGCCACAGAA
AGCAGTGAGGAAATAGAGAACATATGGAGAACAAGTCTCGTGGAGGAGATTGTTCATATCGTGCAAATCATGTTT
CACCAGCTTCAAGCATCGGTGGAATTTCCAAGTGCAGACCTCCTATTGTCCTGGCTCCAGCTCATGGCTGATTAT
AGCTTCCTGGAGACAATTCAAGCGCCTTGTCAGCAACCCGTGGAAGTGTTGTTGCCCCTTCAAGCTTTCGTGTCA
CTTACCACATTGGCGTTTTTAAAACCCGCTCGCGCCATCTCTTTCCTTCAGAATGAGGAATACATGCAATCCTCG
CTCCAGCCTTACTTCTGCTGTAAGGATAAAATCTCTCAAATCAATGAGATTTTCCTTACTGCATGCGGTGATTTG
AACACCGTGAATCCGGCAGCCTTTTCATGGGGCCTGATCTTGTATACCATCCAAGAGCTGGCAGAAGACAGAAGA
ACCAGCCGAGAGCGTCAATTGAGCCATGCTTTGGCTGCCGCCTACGACGAGCAGACACAGAATGAAGCACTAGCT
CAAGCATCTGTGTCTTCAGATTATGAACAATTGCTTGACTGCGCTAGGACTCCGCAAAGCACGGCGGAAGATGCT
ATTCCCATTCTTACATCTGATTTCCTGAAAGAATCGGCATTCAACACCGTTATCGCCCTGGCTAGTAAGACCGGG
TCAATGTCAGCCGTCGATGATGGCCTGACAACCCGATGGATTCGGTTATCACTTCTCGACCTTATCCGAGTCGCT
ATTATGTTCTTGGATTACTCTCCCGAAATTGTGGGGTCAGTCCTGGCTATCTTAAATGATGATGACAACGGGCTG
TCAAGAGACTCAAATTCCCTAGGTCCTGCCAGCGATCCTAAGTCTGTATTCGCCAAGGATCAGAATTTGATGGAT
GGCATCTTTCGCATTGCACGGTCCCGTTTCCCTTATGAAACGTCACCATTTTTACTGCTCTGTCGTGCTCTCGTC
AGTGGGCACTCTTTGAATGAAGAAGGTTTGCCGGCTATTCTTGAGGAGGTGGAAACTATGGAATCCTTTACACAG
ATTGTCCCACCCACTTTCCAGGGCTATGCCACCATTCGAGAAGACGAGAACGCCGATTTTGTTTCCCTGCTCCAA
CCCCTCCCAATGTTAGAAACATCGATCCAGAACCGTGCTTTCGAGAGGGAACCAAGCAATGCTGTAATCGTCAGC
GGTTCTTCCGAAATTCCACGGCTGACCGTTGGTCAAGTCATTTCCGATTCAAAACCCGCGGTTATCATGTGGGAG
CATCGATACTCCTGCTTAAGCTTTCTAGGAAGCTGGCTTGAAGAATGGAGCGAGACCGGTGGGCACTCGTCTGAG
TGGACTGATGACACTGCTGCGGAAATTATTGCTCTCTTGGCCGACTTGATAGCCAACTCTAAATCACAAAGCTCT
GGCGATGCAAGCGGCAAAAGGATTCTAGAGATGGCTAGTGATGGGCTGTCCAAACAGGGTGACATCATTTCTGTG
ATCTTCGATATCTTTGAACGCAATTTGCAGACTATCGGCTCCCGAGGAGACTTGGGCAAGTCTTTGGACGTAACC
ATGGCATGTCTGCGCTTTATCAAGGCACTTATAAAGATTTTACCCAGTCGAGTATGGCCTTTCCTTGGTCGCAGC
AGTCTCATCGGGTCCGATGGCAAGGGAGGCATCATGACAGCAATCGTTTCAGCAATGGAAGTTCCTTCCGGCGAG
TATCCGTTCCTCCTCAGTTGTGTTGACCTTGTGGGCGCTGTCATCGATGATGCGGCATCTCGAGCAGTATTGCGA
AAGAGCCCGGGCAGCGTGACAAGCAAACCATCTATCGCATCTGATTGGAGTGCTGGTATTCCATCTCACGTCATG
AGAACTATTATGTTGAACTTTATTCGCACAATGCTGGAGATTTTCAACAGCTGTGGAAATTGGAGGTTCAACCTA
CCAGAACAACGGCTCAAGATCAACTCGATGCTTGCTACTTCGTTCGAGCGTGTTCTGTACTATGCCTTCGGAATC
AATGACAGCCCGAAACTAGAGACCAAAGTGACCGGCGTTTTCTCTACATCTGCGGCGTACATTCTGGATATGCTG
CGCCCTCGGTCAACCGCCGACCTGCCCTTCAACCCAATTCTTCGGTTGATCGCTGAGGGTCTTCAGACTCCCCCA
ACACTTCATCTCAGATATCTTATCCTCTTTGAAGATCAGGTCAACTCTACACTGCGGCTCTGCATCAAACTTGTA
CAGGCAGCCCAACTGGCAGAACAACCTGCCTCGCTTCTGGAGGAACAACTATTCAAAGCCAGCCCGGTCTTAGTC
AAACTCTACGCGCTACATGATGCATACAGATTGCCGGTTGTGTCGCTTCTCGAGATTTTGATCTCAAGCGCCGCT
TCAAATCCGGATAATGAACCACCTTCCCTTGTTGGCCACCTTGGGGCAGAGTCGTCCTGTCTGTTCCTTGATGTA
CTGTCACAACTCGACAAGCCGATGTGTGACAGACCTCTATTTCTTGCAGTATGGCAGCTGCTATCGACATTTGTT
AGCAAGCGTCAGCAGTGGCTTGCAGTTTTCATTCTCACAGGGTCATCCCCTCGGCAGACTCTGAAGAAGGAACCC
ACTTCTAGTGGGCTTAGCATGAGGAGCGTGCCTTTCCTGAAACTGGCGCTTGAGAAATTGTCTCATATTGATCAA
CAAGAGCCGCAAGTAGCCTTAGCGTTGCTCGAGTTTGTCTCTCGTGCCCAAGAAAATTGGCCATGGGCCACTTCC
CACCTGAGCAAGCACCCCCAGTTCTTCAACAGCATAATTAACCACGTCTCAAAATTGAAGATCTCTTCTCTGCCA
GTGATGGACCAAATCTATGCCACGCGGATTGCAGCTGTTGTCGCGGACCTGTGCGCGGTCTATCTGCACTCGGCA
AAGGAAATGGGAGACCGAAGCTTTATAAAGACCTTGATTCCATTAGTTTCGTGGTATGCCAAGGATGCAGTTGAA
GTTTCGGCTTACAATTCTTCATTGCACGCCAACTTGAAAAAGAACTTTGAGATGCGATACGCGGGCTGCAAAATT
GTGGACTTCAAAAGGACACCGCTCGAAGTTCGTCATCTGGGACGGGATTACTACTACGACATGAGTATGGGAGAC
AAACTGCTGTCCTACGACTTTGCCTGGGCTGGCACCAAGAACCGTGGGTTTGCCGAGGAGTTTGAGCGTGCCAAC
ATCAATCTGTCTCTTGTCGAGGCGCAGGTGAGCCTTCTCCATAGCTGGAAGTTCTTCGCTATCGAGCATTGTGCC
GATTTCATGCCCGATACCGAAGTCCGAAAGTCTATGGCACTGGTCGCGCAAAGTTGTTTGAAGGCCAATATTAGC
AGTGGCCCTCCCGAGGCCATCTTTGAGCGAATCCAACAAGCACGCGTTGACTTTGCCCAGGCACTTCTCCAGCGG
CTTGTCGAGGTACATGCTAGAGGCGCCGAAGTCTTCCAGCTGCTCGAGATTACCTGGAACGCACTGCGATCCCGC
CATCTGACATATGAAGACGCTTTGATCAATGATGATACCGATTACTTCCGGTCCCTACTGAACGTGTTGTTCCTT
TCCCTTCAGTTTCACCTTGATGGCCCCTCCCGGAGTGCCCCCGAAGCTATCAATAAGAGGGCTGAGGTTTCTTCG
GGTCTGACTGTCATCGTGGAAGTCGTGAAAACAATAGTGGCCCAGGGCTTCAAATCCCTCACTACTTATCTCCAT
GATGCGCCCGAGAAATGCACGCCAAAAGATTTCGCCATTATCAATGCTATTCTACAGACATGCTTGCAAGTGAAG
AACGCTGATCGTCTCTATGAGCACATCGTGTACCACATTGAGGAATACGACACCGCTCGTCATGCGACGACGCTC
TTCTCCTGGGCCGACCAATTGGCCGTTGCCGGCGACCCTGTGTACGCCGAGCTCAGCATCTCGATTCTGGTCAAA
ATGTCAACCCTGCCCATGCTCGCAGAGCACCTTGCTGTTGATGCTGTCTTGATGAAACTGTCCACCTGCCGTCTT
ACAAACATTCTCTGCCAAAAGAAAGCATTCGGACCCTTTGATCCTGTTCCCCGACTGTATGCCATCTGGACTGGT
GGCTTCCTTCCTCTGTGTCTGAATATGCTCTACAGTGTGATGCGGGCCGCGCCGGAGGTGGCAGCATTCCTGAAC
CAGTTTGAATCTCGCCTGACCCGCGCGACAGAGGCATTCTCCAGCCATACGGCCGTTTCCTCGGTTCCGACATCC
AAGTGGATTAGCCTCAACATGGTCTCGGAAGCCTACTCGCTTGCGCTGATTTCGTTCATCCTGGACCGGTTCCGC
GAGGCGGGTGCCAGTGCTGGAGTTGACGCACAGGCCATCCAAGATCTCAAATGGGATAGGGTGCAGGTCAAGGAA
GATATTGAGGAACTGCTCGGTCGCCGCGCTGCTCTGCGTGCACGCATTGTCGCGACCAATGAAAAGGAGCTGGAA
TGGTCCCGACAGAAGCCTGTCGACCCGACTTCTGAGTCACAGAACCGATTAGAGGAGAAGCTTGTTAGTGAGCTG
AAGGCAACAGTGACGTGTTTGAGTGGGGAGGATTCATGA
Gene >Pro_DTO377G3_2|g2005.t1
ATGGCTCCCGTCCCGGAGGCCTATTTCCCGTCCCTGGACAAGTGCTTCTCCGGGGACGTTCAACTCTTGTATGTC
CACTCTCATCATTTGTCGTTATAGAGGCTAATATGCTGATACAATGTAGGTCATGGAAAAGAGCTTTTCTCTACG
CCATTGATCCCGAAAGTCATGCTAATGATGGAGGCAATATCGATGTCTTCTTCTCACACTCCGAATCCATTCGCC
TACTCTCTGATGGCCTAAAACCGCCCCCCTCCCCCTCCGCAAAATCCAAGTCGGAATTCGAATCCAAAACCGCAG
CAATCCATGTTGAGACCAATGGCCAAAGTTCTTTCGACCTGAAGGAGATCAAGGCGGACACGCTATGGTTAAGCA
AGCAAGCCGGAATCGACGAGATTTCTGCTCTTCGCATCGCTATCTTAGAATGGCAGAACCGCCCGGCAGCGCGTC
TCACCATCGGTTTTTCCAGCGAGGAAGCGACCAGTCTACAGAGTGCGGCTGGGACCGAGAATCTTCGAGGCTCTC
TAGCCGGTCCCAGCTTCGCCAACCTATTGAACCAAACAGCCAGAAGCGACGGTGGTCAATCATTTGAAAAAGAGG
AGAAGAGGCGCTTGCGACTCCGCGAGGTGTATCTCTCCGAGGAAACCCATGTCGTAAAAACACTCCGCAAGCTGC
TTGCTCTGTCCCTACACGATGGTATCTCAGCCGACTCGACCGCCAGTCATGATCGCAAACTTGCTTTGCAGAAGG
TAGGGACCACAATTTTCCAGGACAAGTCGACTGGTGATGGATTGGACCGGTTTCTTCAAGAATGCATCAGCTCGA
TACGTCGTCGGTTAACGAGTTTGGAAGGAGACGGTGGCTGGCTCGGTGCCACAGAAAGCAGTGAGGAAATAGAGA
ACATATGGAGAACAAGTCTCGTGGAGGAGATTGTTCATATCGTGCAAATCATGTTTCACCAGCTTCAAGCATCGG
TGGAATTTCCAAGTGCAGACCTCCTATTGTCCTGGCTCCAGCTCATGGCTGATTATAGCTTCCTGGAGACAATTC
AAGCGGTAAGCCGCCAGTCGCCTATTTTGAGCTCTCGGAATGTTAACGTTTTCTTATAGCCTTGTCAGCAACCCG
TGGAAGTGTTGTTGCCCCTTCAAGCTTTCGTGTCACTTACCACATTGGCGTTTTTAAAACCCGCTCGCGCCATCT
CTTTCCTTCAGAATGAGGAATACATGCAATCCTCGCTCCAGCCTTACTTCTGCTGTAAGGATAAAATCTCTCAAA
TCAATGAGATTTTCCTTACTGCATGCGGTGATTTGAACACCGTGAATCCGGCAGCCTTTTCATGGGGCCTGATCT
TGTATACCATCCAAGAGCTGGCAGAAGACAGAAGAACCAGCCGAGAGCGTCAATTGAGCCATGCTTTGGCTGCCG
CCTACGACGAGCAGACACAGAATGAAGCACTAGCTCAAGCATCTGTGTCTTCAGATTATGAACAATTGCTTGACT
GCGCTAGGACTCCGCAAAGCACGGCGGAAGATGCTATTCCCATTCTTACATCTGATTTCCTGAAAGAATCGGCAT
TCAACACCGTTATCGCCCTGGCTAGTAAGACCGGGTCAATGTCAGCCGTCGATGATGGCCTGACAACCCGATGGA
TTCGGTTATCACTTCTCGACCTTATCCGAGTCGCTATTATGTTCTTGGATTACTCTCCCGAAATTGTGGGGTCAG
TCCTGGCTATCTTAAATGATGATGACAACGGGCTGTCAAGAGACTCAAATTCCCTAGGTCCTGCCAGCGATCCTA
AGTCTGTATTCGCCAAGGATCAGAATTTGATGGATGGCATCTTTCGCATTGCACGGTCCCGTTTCCCTTATGAAA
CGTCACCATTTTTACTGCTCTGTCGTGCTCTCGTCAGTGGGCACTCTTTGAATGAAGAAGGTTTGCCGGCTATTC
TTGAGGAGGTGGAAACTATGGAATCCTTTACACAGATTGTCCCACCCACTTTCCAGGGCTATGCCACCATTCGAG
AAGACGAGAACGCCGATTTTGTTTCCCTGCTCCAACCCCTCCCAATGTTAGAAACATCGATCCAGAACCGTGCTT
TCGAGAGGGAACCAAGCAATGCTGTAATCGTCAGCGGTTCTTCCGAAATTCCACGGCTGACCGTTGGTCAAGTCA
TTTCCGATTCAAAACCCGCGGTTATCATGTGGGAGCATCGATACTCCTGCTTAAGCTTTCTAGGAAGCTGGCTTG
AAGAATGGAGCGAGACCGGTGGGCACTCGTCTGAGTGGACTGATGACACTGCTGCGGAAATTATTGCTCTCTTGG
CCGACTTGATAGCCAACTCTAAATCACAAAGCTCTGGCGATGCAAGCGGCAAAAGGATTCTAGAGATGGCTAGTG
ATGGGCTGTCCAAACAGGGTGACATCATTTCTGTGATCTTCGATATCTTTGAACGCAATTTGCAGACTATCGGCT
CCCGAGGAGACTTGGGCAAGTCTTTGGACGTAACCATGGCATGTCTGCGCTTTATCAAGGCACTTATAAAGATTT
TACCCAGTCGAGTATGGCCTTTCCTTGGTCGCAGCAGTCTCATCGGGTCCGATGGCAAGGGAGGCATCATGACAG
CAATCGTTTCAGCAATGGAAGTTCCTTCCGGCGAGTATCCGTTCCTCCTCAGTTGTGTTGACCTTGTGGGCGCTG
TCATCGATGATGCGGCATCTCGAGCAGTATTGCGAAAGAGCCCGGGCAGCGTGACAAGCAAACCATCTATCGCAT
CTGATTGGAGTGCTGGTATTCCATCTCACGTCATGAGAACTATTATGTTGAACTTTATTCGCACAATGCTGGAGA
TTTTCAACAGCTGTGGAAATTGGAGGTTCAACCTACCAGAACAACGGCTCAAGATCAACTCGATGCTTGCTACTT
CGTTCGAGCGTGTTCTGTACTATGCCTTCGGAATCAATGACAGCCCGAAACTAGAGACCAAAGTGACCGGCGTTT
TCTCTACATCTGCGGCGTACATTCTGGATATGCTGCGCCCTCGGTCAACCGCCGACCTGCCCTTCAACCCAATTC
TTCGGTTGATCGCTGAGGGTCTTCAGACTCCCCCAACACTTCATCTCAGATATCTTATCCTCTTTGAAGATCAGG
TCAACTCTACACTGCGGCTCTGCATCAAACTTGTACAGGCAGCCCAACTGGCAGAACAACCTGCCTCGCTTCTGG
AGGAACAACTATTCAAAGCCAGCCCGGTCTTAGTCAAACTCTACGCGCTACATGATGCATACAGATTGCCGGTTG
TGTCGCTTCTCGAGATTTTGATCTCAAGCGCCGCTTCAAATCCGGATAATGAACCACCTTCCCTTGTTGGCCACC
TTGGGGCAGAGTCGTCCTGTCTGTTCCTTGATGTACTGTCACAACTCGACAAGCCGATGTGTGACAGACCTCTAT
TTCTTGCAGTATGGCAGCTGCTATCGACATTTGTTAGCAAGCGTCAGCAGTGGCTTGCAGTTTTCATTCTCACAG
GGTCATCCCCTCGGCAGACTCTGAAGAAGGAACCCACTTCTAGTGGGCTTAGCATGAGGAGCGTGCCTTTCCTGA
AACTGGCGCTTGAGAAATTGTCTCATATTGATCAACAAGAGCCGCAAGTAGCCTTAGCGTTGCTCGAGTTTGTCT
CTCGTGCCCAAGAAAATTGGCCATGGGCCACTTCCCACCTGAGCAAGCACCCCCAGTTCTTCAACAGCATAATTA
ACCACGTCTCAAAATTGAAGATCTCTTCTCTGCCAGTGATGGACCAAATCTATGCCACGCGGATTGCAGCTGTTG
TCGCGGACCTGTGCGCGGTCTATCTGCACTCGGCAAAGGAAATGGGAGACCGAAGCTTTATAAAGACCTTGATTC
CATTAGTTTCGTGGTATGCCAAGGATGCAGTTGAAGTTTCGGCTTACAATTCTTCATTGCACGCCAACTTGAAAA
AGAACTTTGAGATGCGATACGCGGGCTGCAAAATTGTGGACTTCAAAAGGACACCGCTCGAAGTTCGTCATCTGG
GACGGGATTACTACTACGACATGAGTATGGGAGACAAACTGCTGTCCTACGACTTTGCCTGGGCTGGCACCAAGA
ACCGTGGGTTTGCCGAGGAGTTTGAGCGTGCCAACATCAATCTGTCTCTTGTCGAGGCGCAGGTGGTAGGTTTTC
TTCCCTTCGTTGCATATGAGTTTCTTTACTAACCTCAAAAAGAGCCTTCTCCATAGCTGGAAGTTCTTCGCTATC
GAGCATTGTGCCGATTTCATGCCCGATACCGAAGTCCGAAAGTCTATGGCACTGGTCGCGCAAAGTTGTTTGAAG
GCCAATATTAGCAGTGGCCCTCCCGAGGCCATCTTTGAGCGAATCCAACAAGCACGCGTTGACTTTGCCCAGGCA
CTTCTCCAGCGGCTTGTCGAGGTACATGCTAGAGGCGCCGAAGTCTTCCAGCTGCTCGAGATTACCTGGAACGCA
CTGCGATCCCGCCATCTGACATATGAAGACGCTTTGATCAATGATGATACCGATTACTTCCGGTCCCTACTGAAC
GTGTTGTTCCTTTCCCTTCAGTTTCACCTTGATGGCCCCTCCCGGAGTGCCCCCGAAGCTATCAATAAGAGGGCT
GAGGTTTCTTCGGGTCTGACTGTCATCGTGGAAGTCGTGAAAACAATAGTGGCCCAGGGCTTCAAATCCCTCACT
ACTTATCTCCATGATGCGCCCGAGAAATGCACGCCAAAAGATTTCGCCATTATCAATGCTATTCTACAGACATGC
TTGCAAGTGAAGAACGCTGATCGTCTCTATGAGCACATCGTGTACCACATTGAGGAATACGACACCGCTCGTCAT
GCGACGACGCTCTTCTCCTGGGCCGACCAATTGGCCGTTGCCGGCGACCCTGTGTACGCCGAGCTCAGCATCTCG
ATTCTGGTCAAAATGTCAACCCTGCCCATGCTCGCAGAGCACCTTGCTGTTGATGCTGTCTTGATGAAACTGTCC
ACCTGCCGTCTTACAAACATTCTCTGCCAAAAGAAAGCATTCGGACCCTTTGATCCTGTTCCCCGACTGTATGCC
ATCTGGACTGGTGGCTTCCTTCCTCTGTGTCTGAATATGCTCTACAGTGTGATGCGGGCCGCGCCGGAGGTGGCA
GCATTCCTGAACCAGTTTGAATCTCGCCTGACCCGCGCGACAGAGGCATTCTCCAGCCATACGGCCGTTTCCTCG
GTTCCGACATCCAAGTGGATTAGCCTCAACATGGTCTCGGAAGCCTACTCGCTTGCGCTGATTTCGTTCATCCTG
GACCGGTTCCGCGAGGCGGGTGCCAGTGCTGGAGTTGACGCACAGGCCATCCAAGATCTCAAATGGGATAGGGTG
CAGGTCAAGGAAGATATTGAGGAACTGCTCGGTCGCCGCGCTGCTCTGCGTGCACGCATTGTCGCGACCAATGAA
AAGGAGCTGGAATGGTCCCGACAGAAGCCTGTCGACCCGACTTCTGAGTCACAGAACCGATTAGAGGAGAAGCTT
GTTAGTGAGCTGAAGGCAACAGTGACGTGTTTGAGTGGGGAGGATTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail