Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2004.t1
Gene name
Locationscaffold_02:1395280..1397539
Strand-
Gene length (bp)2259
Transcript length (bp)2259
Coding sequence length (bp)2259
Protein length (aa) 753

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00218 IGPS Indole-3-glycerol phosphate synthase 3.2E-98 240 502
PF00697 PRAI N-(5'phosphoribosyl)anthranilate (PRA) isomerase 1.1E-55 558 745
PF00117 GATase Glutamine amidotransferase class-I 7.0E-48 26 214
PF07722 Peptidase_C26 Peptidase C26 2.5E-05 93 199

GO

GO Term Description Terminal node
GO:0006568 tryptophan metabolic process Yes
GO:0004640 phosphoribosylanthranilate isomerase activity Yes
GO:0016787 hydrolase activity Yes
GO:0004425 indole-3-glycerol-phosphate synthase activity Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0044106 cellular amine metabolic process No
GO:0008152 metabolic process No
GO:0006082 organic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016861 intramolecular oxidoreductase activity, interconverting aldoses and ketoses No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0008150 biological_process No
GO:0016831 carboxy-lyase activity No
GO:0019752 carboxylic acid metabolic process No
GO:0042430 indole-containing compound metabolic process No
GO:0016860 intramolecular oxidoreductase activity No
GO:0043436 oxoacid metabolic process No
GO:0006576 cellular biogenic amine metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0009308 amine metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:0009072 aromatic amino acid family metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016829 lyase activity No
GO:0016853 isomerase activity No
GO:0006586 indolalkylamine metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 47.89 29.36 66.42
5d_25C Five days - 25 degrees Celsius 39.85 24.30 55.40
7d_25C Seven days - 25 degrees Celsius 38.33 23.32 53.34
10d_25C Ten days - 25 degrees Celsius 32.91 19.78 46.04
7d_15C Seven days - 15 degrees Celsius 41.42 25.27 57.58
7d_30C Seven days - 30 degrees Celsius 40.06 24.42 55.71

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.461116 no
3d_25C 7d_25C 0.339234 no
3d_25C 7d_15C 0.586610 no
3d_25C 7d_30C 0.474736 no
3d_25C 10d_25C 0.081384 no
5d_25C 7d_25C 0.905882 no
5d_25C 7d_15C 0.907134 no
5d_25C 7d_30C 0.988807 no
5d_25C 10d_25C 0.453390 no
7d_25C 7d_15C 0.800677 no
7d_25C 7d_30C 0.892935 no
7d_25C 10d_25C 0.569569 no
7d_15C 7d_30C 0.921340 no
7d_15C 10d_25C 0.343343 no
7d_30C 10d_25C 0.441793 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2004.t1
MADLVDHSPHHATKAAKLASASNVILIDNYDSFTWNVYQYLVLEGATVTVYRNDEVTVEDLAAKKPTQLVISPGP
GHPETDAGISNAAIQYFSGKIPIFGVCMGQQCMITSFGGKVDVTGEILHGKTSELKHDSKGVYQGLPTSLQVTRY
HSLAGTQSTIPDCLEVTSRVELGDGSGKNIIMGIRHKEFAVEGVQFHPESILTEYGRKMFRNFLELTTGTWDNKQ
GAAAAAPVDKKLSILDKIYAHRKIAVDEQKKIPALRPEALQAAYDLNIAPPQLSFPERLRQSDYPLSLMAEIKRA
SPSKGIISADVCAPAQAREYAKAGASVISVLTEPEWFKGTIDDLRAVRQSLEGLTNRPAVLRKEFVFDEYQILEA
RLAGADTVLLIVKMLDIELLTRLYHYSRSLGMEPLVEVNTPEEMKIAVDLGSEVIGVNNRDLTSFEVDLGTTSRL
MDQVPESTIVCALSGISGPQDVEAYKKEGVKAILVGEALMRAPDTSAFVAQLLGGSNRKSAGATPSSPLVKICGT
RTEEGALAAIQAGADLIGIIMVQGRSRLVSDDVALGISRVVKSTPRSANTLQQSSNATPLEWFDHSTNILRHPSR
ALLVGVFMNQPLSYVISQQQKLDLDVVQLHGSEPLEWSSLIPVPVIRKFAPGDIGIARRAYHTLPLLDSGAGGSG
ELLEEGGVKKVLDSDDGLRVILAGGLNPDNVVDTVKKLGQSGHKVVGLDVSSGVETNGAQNLEKIRAFVKSAKSI
RQ*
Coding >Pro_DTO377G3_2|g2004.t1
ATGGCGGACCTGGTTGACCACTCCCCCCACCATGCCACCAAAGCGGCCAAATTGGCCAGCGCATCCAACGTGATT
TTGATTGACAACTACGACTCATTTACCTGGAATGTCTACCAGTACCTGGTTCTTGAAGGTGCTACCGTCACAGTA
TACCGCAATGACGAAGTCACTGTTGAGGACTTGGCTGCAAAGAAGCCTACTCAGCTGGTTATCAGTCCTGGCCCG
GGCCACCCCGAGACCGATGCAGGAATCAGTAACGCCGCAATCCAATATTTCAGCGGAAAGATTCCGATATTTGGT
GTGTGCATGGGCCAACAATGTATGATCACCTCGTTTGGTGGTAAGGTGGATGTGACCGGCGAAATTCTGCACGGA
AAAACATCGGAGTTGAAACATGACTCTAAAGGTGTCTACCAGGGATTGCCAACCTCGCTCCAGGTCACTCGGTAC
CATTCGCTTGCCGGAACACAGTCGACTATCCCAGATTGCTTGGAGGTGACCTCGCGAGTTGAGCTGGGGGACGGT
AGTGGCAAGAACATCATTATGGGTATTAGACACAAGGAGTTCGCAGTGGAAGGTGTTCAGTTCCACCCTGAGAGT
ATTTTGACGGAATACGGGCGCAAGATGTTCCGAAACTTCTTAGAGCTCACCACTGGGACCTGGGATAACAAGCAG
GGAGCAGCCGCCGCCGCACCAGTAGACAAGAAGCTATCCATTTTGGATAAGATTTACGCTCATCGCAAAATTGCT
GTTGACGAGCAGAAGAAAATTCCGGCTCTGCGGCCAGAGGCTCTTCAAGCCGCGTATGATCTGAACATTGCGCCT
CCTCAGCTGTCATTCCCTGAGCGCCTGAGACAGTCAGACTATCCTCTTTCACTTATGGCAGAGATCAAGCGTGCA
TCACCCTCAAAGGGCATCATCTCGGCTGATGTATGTGCCCCTGCTCAAGCGCGGGAGTACGCCAAAGCTGGCGCT
AGCGTCATTTCTGTCCTCACAGAGCCGGAGTGGTTCAAGGGCACCATAGATGACCTGCGGGCTGTTCGCCAGAGC
CTGGAGGGACTCACCAACCGACCAGCTGTCCTCCGAAAGGAGTTCGTTTTTGACGAGTATCAAATCCTGGAGGCG
CGTTTGGCTGGAGCTGATACAGTTCTACTCATTGTGAAGATGCTGGACATTGAGCTGTTGACTAGACTGTACCAT
TACTCACGCAGTCTCGGCATGGAGCCCCTGGTCGAAGTCAACACCCCCGAAGAGATGAAGATTGCAGTTGACCTG
GGGTCTGAAGTCATCGGTGTCAACAACCGGGACCTGACAAGCTTCGAGGTCGATCTCGGAACTACCAGTCGCCTA
ATGGATCAAGTGCCTGAGAGCACAATTGTGTGTGCCCTTAGTGGAATCTCGGGGCCCCAGGATGTGGAGGCTTAT
AAGAAAGAAGGTGTTAAGGCCATTCTTGTTGGAGAGGCTCTTATGAGGGCACCTGATACCTCCGCCTTTGTGGCA
CAGCTTCTCGGCGGCTCCAATCGAAAATCTGCTGGTGCTACACCAAGTTCCCCGTTGGTGAAAATATGTGGAACT
CGGACTGAAGAAGGAGCTCTGGCTGCTATCCAAGCTGGTGCAGATTTGATTGGCATTATCATGGTTCAGGGGCGC
TCACGACTTGTCTCGGATGATGTGGCCCTCGGCATTTCCCGGGTGGTTAAGTCGACCCCTCGTTCGGCCAATACA
TTGCAGCAGTCGTCGAACGCTACACCATTGGAATGGTTTGATCACTCTACTAATATCTTGCGTCACCCTTCTCGT
GCTTTGCTCGTGGGCGTGTTCATGAATCAGCCGTTGTCATATGTCATTTCTCAACAACAAAAGTTGGATCTCGAT
GTTGTGCAACTGCATGGGTCTGAGCCATTGGAATGGTCTAGTTTGATTCCAGTTCCTGTCATTCGCAAGTTCGCT
CCTGGTGACATTGGCATTGCTCGCAGAGCATACCACACTCTTCCATTACTGGACTCTGGTGCCGGAGGCTCTGGC
GAGCTTCTCGAGGAGGGCGGGGTCAAAAAGGTCCTCGATAGTGACGATGGATTGAGGGTAATCCTGGCTGGAGGG
CTAAACCCGGACAACGTGGTCGACACGGTGAAAAAGCTGGGCCAGTCGGGCCACAAAGTGGTCGGATTGGATGTC
AGCTCAGGCGTAGAGACAAACGGCGCTCAAAATTTGGAGAAAATTCGAGCATTTGTCAAGTCTGCCAAAAGCATT
CGGCAATGA
Transcript >Pro_DTO377G3_2|g2004.t1
ATGGCGGACCTGGTTGACCACTCCCCCCACCATGCCACCAAAGCGGCCAAATTGGCCAGCGCATCCAACGTGATT
TTGATTGACAACTACGACTCATTTACCTGGAATGTCTACCAGTACCTGGTTCTTGAAGGTGCTACCGTCACAGTA
TACCGCAATGACGAAGTCACTGTTGAGGACTTGGCTGCAAAGAAGCCTACTCAGCTGGTTATCAGTCCTGGCCCG
GGCCACCCCGAGACCGATGCAGGAATCAGTAACGCCGCAATCCAATATTTCAGCGGAAAGATTCCGATATTTGGT
GTGTGCATGGGCCAACAATGTATGATCACCTCGTTTGGTGGTAAGGTGGATGTGACCGGCGAAATTCTGCACGGA
AAAACATCGGAGTTGAAACATGACTCTAAAGGTGTCTACCAGGGATTGCCAACCTCGCTCCAGGTCACTCGGTAC
CATTCGCTTGCCGGAACACAGTCGACTATCCCAGATTGCTTGGAGGTGACCTCGCGAGTTGAGCTGGGGGACGGT
AGTGGCAAGAACATCATTATGGGTATTAGACACAAGGAGTTCGCAGTGGAAGGTGTTCAGTTCCACCCTGAGAGT
ATTTTGACGGAATACGGGCGCAAGATGTTCCGAAACTTCTTAGAGCTCACCACTGGGACCTGGGATAACAAGCAG
GGAGCAGCCGCCGCCGCACCAGTAGACAAGAAGCTATCCATTTTGGATAAGATTTACGCTCATCGCAAAATTGCT
GTTGACGAGCAGAAGAAAATTCCGGCTCTGCGGCCAGAGGCTCTTCAAGCCGCGTATGATCTGAACATTGCGCCT
CCTCAGCTGTCATTCCCTGAGCGCCTGAGACAGTCAGACTATCCTCTTTCACTTATGGCAGAGATCAAGCGTGCA
TCACCCTCAAAGGGCATCATCTCGGCTGATGTATGTGCCCCTGCTCAAGCGCGGGAGTACGCCAAAGCTGGCGCT
AGCGTCATTTCTGTCCTCACAGAGCCGGAGTGGTTCAAGGGCACCATAGATGACCTGCGGGCTGTTCGCCAGAGC
CTGGAGGGACTCACCAACCGACCAGCTGTCCTCCGAAAGGAGTTCGTTTTTGACGAGTATCAAATCCTGGAGGCG
CGTTTGGCTGGAGCTGATACAGTTCTACTCATTGTGAAGATGCTGGACATTGAGCTGTTGACTAGACTGTACCAT
TACTCACGCAGTCTCGGCATGGAGCCCCTGGTCGAAGTCAACACCCCCGAAGAGATGAAGATTGCAGTTGACCTG
GGGTCTGAAGTCATCGGTGTCAACAACCGGGACCTGACAAGCTTCGAGGTCGATCTCGGAACTACCAGTCGCCTA
ATGGATCAAGTGCCTGAGAGCACAATTGTGTGTGCCCTTAGTGGAATCTCGGGGCCCCAGGATGTGGAGGCTTAT
AAGAAAGAAGGTGTTAAGGCCATTCTTGTTGGAGAGGCTCTTATGAGGGCACCTGATACCTCCGCCTTTGTGGCA
CAGCTTCTCGGCGGCTCCAATCGAAAATCTGCTGGTGCTACACCAAGTTCCCCGTTGGTGAAAATATGTGGAACT
CGGACTGAAGAAGGAGCTCTGGCTGCTATCCAAGCTGGTGCAGATTTGATTGGCATTATCATGGTTCAGGGGCGC
TCACGACTTGTCTCGGATGATGTGGCCCTCGGCATTTCCCGGGTGGTTAAGTCGACCCCTCGTTCGGCCAATACA
TTGCAGCAGTCGTCGAACGCTACACCATTGGAATGGTTTGATCACTCTACTAATATCTTGCGTCACCCTTCTCGT
GCTTTGCTCGTGGGCGTGTTCATGAATCAGCCGTTGTCATATGTCATTTCTCAACAACAAAAGTTGGATCTCGAT
GTTGTGCAACTGCATGGGTCTGAGCCATTGGAATGGTCTAGTTTGATTCCAGTTCCTGTCATTCGCAAGTTCGCT
CCTGGTGACATTGGCATTGCTCGCAGAGCATACCACACTCTTCCATTACTGGACTCTGGTGCCGGAGGCTCTGGC
GAGCTTCTCGAGGAGGGCGGGGTCAAAAAGGTCCTCGATAGTGACGATGGATTGAGGGTAATCCTGGCTGGAGGG
CTAAACCCGGACAACGTGGTCGACACGGTGAAAAAGCTGGGCCAGTCGGGCCACAAAGTGGTCGGATTGGATGTC
AGCTCAGGCGTAGAGACAAACGGCGCTCAAAATTTGGAGAAAATTCGAGCATTTGTCAAGTCTGCCAAAAGCATT
CGGCAATGA
Gene >Pro_DTO377G3_2|g2004.t1
ATGGCGGACCTGGTTGACCACTCCCCCCACCATGCCACCAAAGCGGCCAAATTGGCCAGCGCATCCAACGTGATT
TTGATTGACAACTACGACTCATTTACCTGGAATGTCTACCAGTACCTGGTTCTTGAAGGTGCTACCGTCACAGTA
TACCGCAATGACGAAGTCACTGTTGAGGACTTGGCTGCAAAGAAGCCTACTCAGCTGGTTATCAGTCCTGGCCCG
GGCCACCCCGAGACCGATGCAGGAATCAGTAACGCCGCAATCCAATATTTCAGCGGAAAGATTCCGATATTTGGT
GTGTGCATGGGCCAACAATGTATGATCACCTCGTTTGGTGGTAAGGTGGATGTGACCGGCGAAATTCTGCACGGA
AAAACATCGGAGTTGAAACATGACTCTAAAGGTGTCTACCAGGGATTGCCAACCTCGCTCCAGGTCACTCGGTAC
CATTCGCTTGCCGGAACACAGTCGACTATCCCAGATTGCTTGGAGGTGACCTCGCGAGTTGAGCTGGGGGACGGT
AGTGGCAAGAACATCATTATGGGTATTAGACACAAGGAGTTCGCAGTGGAAGGTGTTCAGTTCCACCCTGAGAGT
ATTTTGACGGAATACGGGCGCAAGATGTTCCGAAACTTCTTAGAGCTCACCACTGGGACCTGGGATAACAAGCAG
GGAGCAGCCGCCGCCGCACCAGTAGACAAGAAGCTATCCATTTTGGATAAGATTTACGCTCATCGCAAAATTGCT
GTTGACGAGCAGAAGAAAATTCCGGCTCTGCGGCCAGAGGCTCTTCAAGCCGCGTATGATCTGAACATTGCGCCT
CCTCAGCTGTCATTCCCTGAGCGCCTGAGACAGTCAGACTATCCTCTTTCACTTATGGCAGAGATCAAGCGTGCA
TCACCCTCAAAGGGCATCATCTCGGCTGATGTATGTGCCCCTGCTCAAGCGCGGGAGTACGCCAAAGCTGGCGCT
AGCGTCATTTCTGTCCTCACAGAGCCGGAGTGGTTCAAGGGCACCATAGATGACCTGCGGGCTGTTCGCCAGAGC
CTGGAGGGACTCACCAACCGACCAGCTGTCCTCCGAAAGGAGTTCGTTTTTGACGAGTATCAAATCCTGGAGGCG
CGTTTGGCTGGAGCTGATACAGTTCTACTCATTGTGAAGATGCTGGACATTGAGCTGTTGACTAGACTGTACCAT
TACTCACGCAGTCTCGGCATGGAGCCCCTGGTCGAAGTCAACACCCCCGAAGAGATGAAGATTGCAGTTGACCTG
GGGTCTGAAGTCATCGGTGTCAACAACCGGGACCTGACAAGCTTCGAGGTCGATCTCGGAACTACCAGTCGCCTA
ATGGATCAAGTGCCTGAGAGCACAATTGTGTGTGCCCTTAGTGGAATCTCGGGGCCCCAGGATGTGGAGGCTTAT
AAGAAAGAAGGTGTTAAGGCCATTCTTGTTGGAGAGGCTCTTATGAGGGCACCTGATACCTCCGCCTTTGTGGCA
CAGCTTCTCGGCGGCTCCAATCGAAAATCTGCTGGTGCTACACCAAGTTCCCCGTTGGTGAAAATATGTGGAACT
CGGACTGAAGAAGGAGCTCTGGCTGCTATCCAAGCTGGTGCAGATTTGATTGGCATTATCATGGTTCAGGGGCGC
TCACGACTTGTCTCGGATGATGTGGCCCTCGGCATTTCCCGGGTGGTTAAGTCGACCCCTCGTTCGGCCAATACA
TTGCAGCAGTCGTCGAACGCTACACCATTGGAATGGTTTGATCACTCTACTAATATCTTGCGTCACCCTTCTCGT
GCTTTGCTCGTGGGCGTGTTCATGAATCAGCCGTTGTCATATGTCATTTCTCAACAACAAAAGTTGGATCTCGAT
GTTGTGCAACTGCATGGGTCTGAGCCATTGGAATGGTCTAGTTTGATTCCAGTTCCTGTCATTCGCAAGTTCGCT
CCTGGTGACATTGGCATTGCTCGCAGAGCATACCACACTCTTCCATTACTGGACTCTGGTGCCGGAGGCTCTGGC
GAGCTTCTCGAGGAGGGCGGGGTCAAAAAGGTCCTCGATAGTGACGATGGATTGAGGGTAATCCTGGCTGGAGGG
CTAAACCCGGACAACGTGGTCGACACGGTGAAAAAGCTGGGCCAGTCGGGCCACAAAGTGGTCGGATTGGATGTC
AGCTCAGGCGTAGAGACAAACGGCGCTCAAAATTTGGAGAAAATTCGAGCATTTGTCAAGTCTGCCAAAAGCATT
CGGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail