Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2001.t1
Gene name
Locationscaffold_02:1387643..1390933
Strand-
Gene length (bp)3290
Transcript length (bp)3240
Coding sequence length (bp)3240
Protein length (aa) 1080

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09416 UPF1_Zn_bind RNA helicase (UPF2 interacting domain) 2.6E-71 69 220
PF13087 AAA_12 AAA domain 1.1E-59 633 829
PF13086 AAA_11 AAA domain 2.1E-21 424 522
PF13086 AAA_11 AAA domain 1.8E-30 526 626
PF18141 DUF5599 Domain of unknown function (DUF5599) 2.6E-32 273 367
PF13604 AAA_30 AAA domain 1.6E-12 424 622
PF13245 AAA_19 AAA domain 2.1E-10 428 621
PF04851 ResIII Type III restriction enzyme, res subunit 9.5E-06 429 552

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004386 helicase activity Yes
GO:0016787 hydrolase activity Yes
GO:0005737 cytoplasm Yes
GO:0003677 DNA binding Yes
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Yes
GO:0008270 zinc ion binding Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0010605 negative regulation of macromolecule metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044238 primary metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0019439 aromatic compound catabolic process No
GO:0009056 catabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0046872 metal ion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0006402 mRNA catabolic process No
GO:0097159 organic cyclic compound binding No
GO:0046914 transition metal ion binding No
GO:0044464 cell part No
GO:0050789 regulation of biological process No
GO:0046483 heterocycle metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0065007 biological regulation No
GO:0090304 nucleic acid metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044265 cellular macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0009892 negative regulation of metabolic process No
GO:0000956 nuclear-transcribed mRNA catabolic process No
GO:1901575 organic substance catabolic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016462 pyrophosphatase activity No
GO:0071704 organic substance metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016071 mRNA metabolic process No
GO:0005488 binding No
GO:0000166 nucleotide binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003676 nucleic acid binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044424 intracellular part No
GO:0019222 regulation of metabolic process No
GO:0003674 molecular_function No
GO:0016070 RNA metabolic process No
GO:0043169 cation binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0044237 cellular metabolic process No
GO:0010468 regulation of gene expression No
GO:0036094 small molecule binding No
GO:0048519 negative regulation of biological process No
GO:0030554 adenyl nucleotide binding No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0009987 cellular process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006401 RNA catabolic process No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0008150 biological_process No
GO:0010629 negative regulation of gene expression No
GO:0046700 heterocycle catabolic process No
GO:0008144 drug binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2001.t1
MSYQPEDPSAGVDVNEIALGRARPRRHDDEDEGSETFEDDDMESTVGVPANGNQKSQGNGEEEIELPAHACAYCG
IHNASSVVKCLACNKWFCSARGNTSSSHIVNHLVRARHKEVQLHPGSSLGDTILECYNCGTKNVFLLGFIPAKSD
TVVVLLCRQPCASMPSSKDMNWDTSRWQPLIEDRSFLPWLVGAPTDQEQLRARHLSPQLIAKLEEMWKDNSQATL
EDLEKATAVDDEPAPVLLRYDDAFQYQNIFGPLVKIEADYDRKLKESQSQDGLIVRWDLGLNNKHLASFVLPKLE
LGDVKLAVGDEMRIKYNGELRPKWEGVGYVIKIPNNQSDEVTIELRAKGDHKSVPTECTHNFMADYVWKSTSFDR
MQCAMKTFAVDEQSVSGYIFHRLLGHEVAAAPMKTQIPKKFSVPGLPDLNGSQINAVKSVLQRPLSLIQGPPGTG
KTVTSATIIYHLAKINGGQVLVCAPSNVAVDQLCERIHRTGLKTVRVTAKSREDVESAVGFLSLHEQVRMNDSNI
ELVKLNQLKAELGELSSQDEKRLKQLTRSAEREILTNADVICCTCVGAGDPRLSKGKFRTVLIDESTQSAEPECM
IPLVLGCKQVVLVGDHQQLGPVIMNKKAAKAGLNQSLFERLVILGCSPIRLNVQYRMHPCLSEFPSNMFYEGSLQ
NGITIADRVRRDVDFPWPIIDDPMMFWSNLGNEEISASGTSYLNRTEATNVEKIVTRFFKAGVQPRDIGIITPYE
GQRSYIVSSMQANGTFKKEHYKEIEVASVDAFQGREKDYIILSCVRSNDHQGIGFLSDPRRLNVALTRARFGLVI
LGNPKVLSKHPLWNCLLQHFKERHCLVEGPLSNLQESLIQFSRPKQAYRGPQRFQMSFSQTNNGPNNAVNGRNGG
HRNEYHDSGSVVGYIPDDVSSVHGSALGGVGLPSGYPPMFQNFGESWPAISGGRRANGGRPKGAPSVAGESVAAT
ESDVTSSVTDGRSVDQGGVSLTGLSINEMGKQPSLSQSDRLKRYVESGGREPYRAGVPDNGSIFGGSSASIRVTR
GVPGQNTHDDDDARSVSTAFASQVGGNYD*
Coding >Pro_DTO377G3_2|g2001.t1
ATGAGCTACCAACCGGAGGACCCCTCGGCGGGAGTTGACGTTAATGAGATTGCACTTGGGCGCGCACGTCCACGC
CGACATGATGACGAAGATGAAGGCTCTGAAACCTTTGAAGATGACGACATGGAAAGCACAGTCGGTGTACCCGCA
AATGGGAATCAGAAGTCCCAAGGAAATGGAGAGGAGGAAATAGAGCTCCCTGCTCATGCATGCGCATACTGCGGC
ATCCACAACGCGAGCAGCGTCGTCAAATGTCTTGCTTGCAATAAGTGGTTCTGCAGTGCACGTGGCAATACTTCT
TCGTCCCATATCGTCAATCACCTTGTCCGAGCTCGTCATAAGGAAGTCCAACTCCACCCGGGCTCTTCTTTAGGA
GATACTATTCTGGAATGCTACAACTGTGGCACCAAAAATGTATTTTTGCTTGGCTTCATCCCCGCAAAATCCGAT
ACTGTTGTTGTCCTGCTTTGTCGGCAGCCATGTGCCTCTATGCCATCCTCCAAGGACATGAATTGGGACACTTCA
CGATGGCAGCCTCTTATTGAGGATCGTTCTTTCCTCCCCTGGCTCGTAGGAGCACCTACTGACCAAGAACAACTC
CGAGCTCGTCACCTCAGTCCTCAATTGATTGCGAAGCTGGAGGAAATGTGGAAAGACAACTCTCAGGCGACTCTG
GAAGACCTAGAGAAGGCCACCGCAGTGGATGATGAGCCTGCGCCAGTCCTACTTCGCTACGACGATGCTTTCCAA
TACCAAAATATTTTCGGCCCACTTGTTAAGATCGAGGCTGATTACGACCGCAAGTTGAAGGAATCTCAATCCCAA
GATGGATTGATCGTGCGCTGGGATCTTGGTCTCAACAACAAGCATCTAGCAAGCTTTGTGCTGCCTAAGCTTGAG
CTAGGAGATGTCAAATTGGCAGTGGGTGACGAGATGCGCATCAAGTACAATGGTGAATTGCGTCCTAAGTGGGAG
GGTGTCGGGTATGTCATCAAGATTCCGAACAATCAATCTGATGAGGTCACTATCGAACTTCGCGCCAAGGGCGAC
CACAAGTCAGTTCCCACCGAATGCACGCACAATTTTATGGCCGACTATGTCTGGAAGTCGACTTCCTTCGACCGC
ATGCAATGTGCTATGAAGACCTTTGCCGTAGATGAGCAGAGTGTCTCAGGATACATTTTCCATCGTCTCCTTGGC
CATGAGGTTGCTGCAGCTCCTATGAAGACCCAGATTCCAAAGAAATTTAGTGTTCCAGGTCTACCAGATCTGAAT
GGCAGTCAAATTAACGCAGTTAAAAGTGTCCTCCAACGACCTCTCAGTTTGATCCAAGGTCCTCCCGGAACCGGT
AAGACTGTTACATCGGCCACTATTATCTATCATCTTGCCAAGATCAACGGAGGTCAAGTTCTTGTCTGCGCTCCA
TCCAACGTCGCCGTTGATCAGCTCTGCGAACGTATTCACCGGACGGGTCTCAAGACCGTGCGAGTTACTGCTAAA
TCTCGCGAAGATGTGGAATCTGCCGTTGGTTTCCTTTCGCTGCACGAGCAGGTTCGCATGAACGATAGCAACATT
GAGCTGGTAAAACTCAACCAGCTCAAGGCAGAACTTGGGGAATTGTCCAGCCAAGACGAAAAGCGCCTGAAGCAA
CTTACTCGCTCTGCTGAGCGTGAAATTCTCACTAACGCAGATGTGATCTGCTGTACTTGTGTTGGTGCAGGTGAT
CCTCGTCTTTCAAAGGGCAAGTTCCGCACTGTCCTGATTGACGAATCAACCCAATCTGCTGAGCCCGAGTGTATG
ATTCCTCTAGTTCTGGGCTGCAAACAAGTGGTCTTGGTAGGTGATCACCAGCAACTTGGCCCTGTGATCATGAAC
AAGAAGGCCGCCAAGGCCGGTCTGAACCAGTCTTTGTTCGAGCGTCTCGTGATTTTGGGCTGCTCTCCTATCCGA
TTGAATGTCCAGTATCGTATGCACCCGTGCCTTTCCGAATTCCCATCCAATATGTTCTATGAAGGCTCGCTGCAG
AACGGTATCACCATTGCAGATCGTGTCCGCCGTGACGTTGACTTCCCTTGGCCCATCATTGATGATCCGATGATG
TTTTGGTCAAACCTGGGCAACGAAGAAATCTCCGCGTCTGGCACCTCGTATCTTAACCGTACTGAAGCTACCAAC
GTCGAGAAGATTGTCACTCGCTTCTTCAAGGCAGGTGTTCAGCCTAGGGATATTGGTATCATCACTCCATACGAG
GGACAGCGGAGCTACATCGTCAGCTCTATGCAGGCAAACGGTACCTTCAAGAAAGAACATTACAAGGAGATCGAG
GTTGCGTCGGTCGACGCATTCCAAGGCAGAGAGAAGGATTATATTATCCTTTCTTGTGTTCGTTCTAATGATCAC
CAAGGTATTGGTTTCCTGAGCGATCCCCGTCGTCTCAACGTGGCCCTTACTCGTGCTCGATTTGGCCTGGTCATC
CTCGGAAACCCCAAGGTCTTGTCTAAGCACCCATTGTGGAATTGCCTTTTGCAGCACTTCAAGGAACGCCACTGT
CTTGTGGAGGGGCCGCTTTCCAACCTTCAGGAGTCCTTGATTCAATTCAGCCGGCCCAAGCAAGCATACAGAGGC
CCGCAGCGGTTCCAGATGTCTTTCAGTCAGACAAATAATGGCCCAAATAATGCAGTGAATGGTCGCAACGGTGGT
CACCGCAACGAGTATCATGACTCGGGGTCTGTGGTGGGCTATATCCCTGACGATGTATCTTCTGTTCATGGCTCG
GCACTTGGTGGTGTTGGCCTTCCATCTGGCTACCCCCCTATGTTCCAGAATTTTGGCGAGTCCTGGCCTGCGATC
TCTGGCGGTCGTCGAGCGAACGGTGGCCGACCCAAGGGAGCCCCCAGTGTGGCTGGCGAGTCAGTCGCTGCCACT
GAGTCCGATGTCACATCCAGCGTCACTGACGGACGGAGCGTTGATCAAGGCGGTGTCAGTCTCACTGGCCTGAGC
ATTAATGAAATGGGCAAGCAGCCCAGTCTCAGTCAATCTGACCGTTTGAAGCGCTATGTCGAGTCTGGAGGACGC
GAGCCTTACAGGGCTGGAGTTCCGGACAACGGCAGCATCTTCGGAGGCAGCTCCGCTAGCATTCGAGTGACTCGC
GGCGTGCCGGGCCAAAACACGCACGACGACGATGATGCCCGTAGCGTCTCTACTGCTTTCGCTAGCCAAGTTGGT
GGCAACTATGACTGA
Transcript >Pro_DTO377G3_2|g2001.t1
ATGAGCTACCAACCGGAGGACCCCTCGGCGGGAGTTGACGTTAATGAGATTGCACTTGGGCGCGCACGTCCACGC
CGACATGATGACGAAGATGAAGGCTCTGAAACCTTTGAAGATGACGACATGGAAAGCACAGTCGGTGTACCCGCA
AATGGGAATCAGAAGTCCCAAGGAAATGGAGAGGAGGAAATAGAGCTCCCTGCTCATGCATGCGCATACTGCGGC
ATCCACAACGCGAGCAGCGTCGTCAAATGTCTTGCTTGCAATAAGTGGTTCTGCAGTGCACGTGGCAATACTTCT
TCGTCCCATATCGTCAATCACCTTGTCCGAGCTCGTCATAAGGAAGTCCAACTCCACCCGGGCTCTTCTTTAGGA
GATACTATTCTGGAATGCTACAACTGTGGCACCAAAAATGTATTTTTGCTTGGCTTCATCCCCGCAAAATCCGAT
ACTGTTGTTGTCCTGCTTTGTCGGCAGCCATGTGCCTCTATGCCATCCTCCAAGGACATGAATTGGGACACTTCA
CGATGGCAGCCTCTTATTGAGGATCGTTCTTTCCTCCCCTGGCTCGTAGGAGCACCTACTGACCAAGAACAACTC
CGAGCTCGTCACCTCAGTCCTCAATTGATTGCGAAGCTGGAGGAAATGTGGAAAGACAACTCTCAGGCGACTCTG
GAAGACCTAGAGAAGGCCACCGCAGTGGATGATGAGCCTGCGCCAGTCCTACTTCGCTACGACGATGCTTTCCAA
TACCAAAATATTTTCGGCCCACTTGTTAAGATCGAGGCTGATTACGACCGCAAGTTGAAGGAATCTCAATCCCAA
GATGGATTGATCGTGCGCTGGGATCTTGGTCTCAACAACAAGCATCTAGCAAGCTTTGTGCTGCCTAAGCTTGAG
CTAGGAGATGTCAAATTGGCAGTGGGTGACGAGATGCGCATCAAGTACAATGGTGAATTGCGTCCTAAGTGGGAG
GGTGTCGGGTATGTCATCAAGATTCCGAACAATCAATCTGATGAGGTCACTATCGAACTTCGCGCCAAGGGCGAC
CACAAGTCAGTTCCCACCGAATGCACGCACAATTTTATGGCCGACTATGTCTGGAAGTCGACTTCCTTCGACCGC
ATGCAATGTGCTATGAAGACCTTTGCCGTAGATGAGCAGAGTGTCTCAGGATACATTTTCCATCGTCTCCTTGGC
CATGAGGTTGCTGCAGCTCCTATGAAGACCCAGATTCCAAAGAAATTTAGTGTTCCAGGTCTACCAGATCTGAAT
GGCAGTCAAATTAACGCAGTTAAAAGTGTCCTCCAACGACCTCTCAGTTTGATCCAAGGTCCTCCCGGAACCGGT
AAGACTGTTACATCGGCCACTATTATCTATCATCTTGCCAAGATCAACGGAGGTCAAGTTCTTGTCTGCGCTCCA
TCCAACGTCGCCGTTGATCAGCTCTGCGAACGTATTCACCGGACGGGTCTCAAGACCGTGCGAGTTACTGCTAAA
TCTCGCGAAGATGTGGAATCTGCCGTTGGTTTCCTTTCGCTGCACGAGCAGGTTCGCATGAACGATAGCAACATT
GAGCTGGTAAAACTCAACCAGCTCAAGGCAGAACTTGGGGAATTGTCCAGCCAAGACGAAAAGCGCCTGAAGCAA
CTTACTCGCTCTGCTGAGCGTGAAATTCTCACTAACGCAGATGTGATCTGCTGTACTTGTGTTGGTGCAGGTGAT
CCTCGTCTTTCAAAGGGCAAGTTCCGCACTGTCCTGATTGACGAATCAACCCAATCTGCTGAGCCCGAGTGTATG
ATTCCTCTAGTTCTGGGCTGCAAACAAGTGGTCTTGGTAGGTGATCACCAGCAACTTGGCCCTGTGATCATGAAC
AAGAAGGCCGCCAAGGCCGGTCTGAACCAGTCTTTGTTCGAGCGTCTCGTGATTTTGGGCTGCTCTCCTATCCGA
TTGAATGTCCAGTATCGTATGCACCCGTGCCTTTCCGAATTCCCATCCAATATGTTCTATGAAGGCTCGCTGCAG
AACGGTATCACCATTGCAGATCGTGTCCGCCGTGACGTTGACTTCCCTTGGCCCATCATTGATGATCCGATGATG
TTTTGGTCAAACCTGGGCAACGAAGAAATCTCCGCGTCTGGCACCTCGTATCTTAACCGTACTGAAGCTACCAAC
GTCGAGAAGATTGTCACTCGCTTCTTCAAGGCAGGTGTTCAGCCTAGGGATATTGGTATCATCACTCCATACGAG
GGACAGCGGAGCTACATCGTCAGCTCTATGCAGGCAAACGGTACCTTCAAGAAAGAACATTACAAGGAGATCGAG
GTTGCGTCGGTCGACGCATTCCAAGGCAGAGAGAAGGATTATATTATCCTTTCTTGTGTTCGTTCTAATGATCAC
CAAGGTATTGGTTTCCTGAGCGATCCCCGTCGTCTCAACGTGGCCCTTACTCGTGCTCGATTTGGCCTGGTCATC
CTCGGAAACCCCAAGGTCTTGTCTAAGCACCCATTGTGGAATTGCCTTTTGCAGCACTTCAAGGAACGCCACTGT
CTTGTGGAGGGGCCGCTTTCCAACCTTCAGGAGTCCTTGATTCAATTCAGCCGGCCCAAGCAAGCATACAGAGGC
CCGCAGCGGTTCCAGATGTCTTTCAGTCAGACAAATAATGGCCCAAATAATGCAGTGAATGGTCGCAACGGTGGT
CACCGCAACGAGTATCATGACTCGGGGTCTGTGGTGGGCTATATCCCTGACGATGTATCTTCTGTTCATGGCTCG
GCACTTGGTGGTGTTGGCCTTCCATCTGGCTACCCCCCTATGTTCCAGAATTTTGGCGAGTCCTGGCCTGCGATC
TCTGGCGGTCGTCGAGCGAACGGTGGCCGACCCAAGGGAGCCCCCAGTGTGGCTGGCGAGTCAGTCGCTGCCACT
GAGTCCGATGTCACATCCAGCGTCACTGACGGACGGAGCGTTGATCAAGGCGGTGTCAGTCTCACTGGCCTGAGC
ATTAATGAAATGGGCAAGCAGCCCAGTCTCAGTCAATCTGACCGTTTGAAGCGCTATGTCGAGTCTGGAGGACGC
GAGCCTTACAGGGCTGGAGTTCCGGACAACGGCAGCATCTTCGGAGGCAGCTCCGCTAGCATTCGAGTGACTCGC
GGCGTGCCGGGCCAAAACACGCACGACGACGATGATGCCCGTAGCGTCTCTACTGCTTTCGCTAGCCAAGTTGGT
GGCAACTATGACTGA
Gene >Pro_DTO377G3_2|g2001.t1
ATGAGCTACCAACCGGAGGACCCCTCGGCGGGAGTTGACGTTAATGAGATTGCACTTGGGCGCGCACGTCCACGC
CGACATGATGACGAAGATGAAGGCTCTGAAACCTTTGAAGATGACGACATGGAAAGCACAGTCGGTGTACCCGCA
AATGGGAATCAGAAGTCCCAAGGAAATGGAGAGGAGGAAATAGAGCTCCCTGCTCATGCATGCGCGTCAGTGTTT
ATATTCCCTTAGTGGATCGCATTTACTGATTATGTTATAGATACTGCGGCATCCACAACGCGAGCAGCGTCGTCA
AATGTCTTGCTTGCAATAAGTGGTTCTGCAGTGCACGTGGCAATACTTCTTCGTCCCATATCGTCAATCACCTTG
TCCGAGCTCGTCATAAGGAAGTCCAACTCCACCCGGGCTCTTCTTTAGGAGATACTATTCTGGAATGCTACAACT
GTGGCACCAAAAATGTATTTTTGCTTGGCTTCATCCCCGCAAAATCCGATACTGTTGTTGTCCTGCTTTGTCGGC
AGCCATGTGCCTCTATGCCATCCTCCAAGGACATGAATTGGGACACTTCACGATGGCAGCCTCTTATTGAGGATC
GTTCTTTCCTCCCCTGGCTCGTAGGAGCACCTACTGACCAAGAACAACTCCGAGCTCGTCACCTCAGTCCTCAAT
TGATTGCGAAGCTGGAGGAAATGTGGAAAGACAACTCTCAGGCGACTCTGGAAGACCTAGAGAAGGCCACCGCAG
TGGATGATGAGCCTGCGCCAGTCCTACTTCGCTACGACGATGCTTTCCAATACCAAAATATTTTCGGCCCACTTG
TTAAGATCGAGGCTGATTACGACCGCAAGTTGAAGGAATCTCAATCCCAAGATGGATTGATCGTGCGCTGGGATC
TTGGTCTCAACAACAAGCATCTAGCAAGCTTTGTGCTGCCTAAGCTTGAGCTAGGAGATGTCAAATTGGCAGTGG
GTGACGAGATGCGCATCAAGTACAATGGTGAATTGCGTCCTAAGTGGGAGGGTGTCGGGTATGTCATCAAGATTC
CGAACAATCAATCTGATGAGGTCACTATCGAACTTCGCGCCAAGGGCGACCACAAGTCAGTTCCCACCGAATGCA
CGCACAATTTTATGGCCGACTATGTCTGGAAGTCGACTTCCTTCGACCGCATGCAATGTGCTATGAAGACCTTTG
CCGTAGATGAGCAGAGTGTCTCAGGATACATTTTCCATCGTCTCCTTGGCCATGAGGTTGCTGCAGCTCCTATGA
AGACCCAGATTCCAAAGAAATTTAGTGTTCCAGGTCTACCAGATCTGAATGGCAGTCAAATTAACGCAGTTAAAA
GTGTCCTCCAACGACCTCTCAGTTTGATCCAAGGTCCTCCCGGAACCGGTAAGACTGTTACATCGGCCACTATTA
TCTATCATCTTGCCAAGATCAACGGAGGTCAAGTTCTTGTCTGCGCTCCATCCAACGTCGCCGTTGATCAGCTCT
GCGAACGTATTCACCGGACGGGTCTCAAGACCGTGCGAGTTACTGCTAAATCTCGCGAAGATGTGGAATCTGCCG
TTGGTTTCCTTTCGCTGCACGAGCAGGTTCGCATGAACGATAGCAACATTGAGCTGGTAAAACTCAACCAGCTCA
AGGCAGAACTTGGGGAATTGTCCAGCCAAGACGAAAAGCGCCTGAAGCAACTTACTCGCTCTGCTGAGCGTGAAA
TTCTCACTAACGCAGATGTGATCTGCTGTACTTGTGTTGGTGCAGGTGATCCTCGTCTTTCAAAGGGCAAGTTCC
GCACTGTCCTGATTGACGAATCAACCCAATCTGCTGAGCCCGAGTGTATGATTCCTCTAGTTCTGGGCTGCAAAC
AAGTGGTCTTGGTAGGTGATCACCAGCAACTTGGCCCTGTGATCATGAACAAGAAGGCCGCCAAGGCCGGTCTGA
ACCAGTCTTTGTTCGAGCGTCTCGTGATTTTGGGCTGCTCTCCTATCCGATTGAATGTCCAGTATCGTATGCACC
CGTGCCTTTCCGAATTCCCATCCAATATGTTCTATGAAGGCTCGCTGCAGAACGGTATCACCATTGCAGATCGTG
TCCGCCGTGACGTTGACTTCCCTTGGCCCATCATTGATGATCCGATGATGTTTTGGTCAAACCTGGGCAACGAAG
AAATCTCCGCGTCTGGCACCTCGTATCTTAACCGTACTGAAGCTACCAACGTCGAGAAGATTGTCACTCGCTTCT
TCAAGGCAGGTGTTCAGCCTAGGGATATTGGTATCATCACTCCATACGAGGGACAGCGGAGCTACATCGTCAGCT
CTATGCAGGCAAACGGTACCTTCAAGAAAGAACATTACAAGGAGATCGAGGTTGCGTCGGTCGACGCATTCCAAG
GCAGAGAGAAGGATTATATTATCCTTTCTTGTGTTCGTTCTAATGATCACCAAGGTATTGGTTTCCTGAGCGATC
CCCGTCGTCTCAACGTGGCCCTTACTCGTGCTCGATTTGGCCTGGTCATCCTCGGAAACCCCAAGGTCTTGTCTA
AGCACCCATTGTGGAATTGCCTTTTGCAGCACTTCAAGGAACGCCACTGTCTTGTGGAGGGGCCGCTTTCCAACC
TTCAGGAGTCCTTGATTCAATTCAGCCGGCCCAAGCAAGCATACAGAGGCCCGCAGCGGTTCCAGATGTCTTTCA
GTCAGACAAATAATGGCCCAAATAATGCAGTGAATGGTCGCAACGGTGGTCACCGCAACGAGTATCATGACTCGG
GGTCTGTGGTGGGCTATATCCCTGACGATGTATCTTCTGTTCATGGCTCGGCACTTGGTGGTGTTGGCCTTCCAT
CTGGCTACCCCCCTATGTTCCAGAATTTTGGCGAGTCCTGGCCTGCGATCTCTGGCGGTCGTCGAGCGAACGGTG
GCCGACCCAAGGGAGCCCCCAGTGTGGCTGGCGAGTCAGTCGCTGCCACTGAGTCCGATGTCACATCCAGCGTCA
CTGACGGACGGAGCGTTGATCAAGGCGGTGTCAGTCTCACTGGCCTGAGCATTAATGAAATGGGCAAGCAGCCCA
GTCTCAGTCAATCTGACCGTTTGAAGCGCTATGTCGAGTCTGGAGGACGCGAGCCTTACAGGGCTGGAGTTCCGG
ACAACGGCAGCATCTTCGGAGGCAGCTCCGCTAGCATTCGAGTGACTCGCGGCGTGCCGGGCCAAAACACGCACG
ACGACGATGATGCCCGTAGCGTCTCTACTGCTTTCGCTAGCCAAGTTGGTGGCAACTATGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail