Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g199.t1
Gene name
Locationscaffold_01:521229..522912
Strand-
Gene length (bp)1683
Transcript length (bp)1683
Coding sequence length (bp)1683
Protein length (aa) 561

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2) 6.5E-06 34 326

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 427 449 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 355.99 202.96 509.02
5d_25C Five days - 25 degrees Celsius 238.54 140.41 336.68
7d_25C Seven days - 25 degrees Celsius 148.75 88.71 208.79
10d_25C Ten days - 25 degrees Celsius 107.14 65.47 148.82
7d_15C Seven days - 15 degrees Celsius 284.34 160.72 407.96
7d_30C Seven days - 30 degrees Celsius 126.50 74.68 178.31

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.086979 no
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.407905 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.029538 yes
5d_25C 7d_15C 0.530108 no
5d_25C 7d_30C 0.002761 yes
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.002761 yes
7d_25C 7d_30C 0.544260 no
7d_25C 10d_25C 0.148408 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.523769 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g199.t1
MVSAQDSQSIQKVWGVFAFTVYGDSKPSELTSSRTLTDYGANELATAASDFRYRYVSGGSNTIIQNISPIILDSN
DVVVLSATDQNIVGSAQAFMQGLYPPLGSMNIPSSQIANGSFTQAPLNGYQYPRIVTVGNADPQSILIEGHAMCD
MYNAAEGEYRGSNEAQDITRDTDAFYRKLWKLALSGAYDDTSATYTNAVAISEYLDYEVVHNDSLLESLNHADII
RARSLADQYAWSTNSQQSSSSGSAIRVASPIAGQTLASSILEAFDLNIQASGTRQKMTLLFGGDEPAVALSSLLG
LANQHQPNFFSRLVRGGSFVFELYSYENSSNLYPTYPGMDNLYVRFLLHNGTDNTTDFEMYSLFGHGPSRASIPY
TEFHSELETFALASTEEWCLRCNAETVFCNGVLDQTVSQPKKNRGLAPAVAGVIGAVTTLAVIGLTAVIVFLICR
ARKGRYPKKGSLGGFKGPSKLASDTDLSFSEPIWGNSKTDSTQASSGLAAGVGVAVQGHERTGSWEMRQGKKEIG
NIEPDGMEVMSPSEENGEYWGVHSGLQPVKIRESV*
Coding >Pro_DTO377G3_2|g199.t1
ATGGTCTCTGCCCAAGACTCCCAATCCATCCAGAAAGTATGGGGAGTCTTTGCATTTACCGTCTACGGAGACAGC
AAGCCCAGTGAGCTCACCAGCTCTCGAACATTGACCGACTACGGAGCCAACGAACTCGCCACGGCAGCATCGGAT
TTCCGTTATCGTTATGTGTCTGGAGGCTCTAATACTATAATCCAGAACATATCCCCAATAATTTTGGACTCAAAC
GATGTGGTTGTGCTCTCGGCAACGGATCAGAACATTGTTGGTTCCGCCCAAGCCTTCATGCAGGGTCTATACCCA
CCATTGGGCTCAATGAACATACCGAGCAGCCAAATTGCGAACGGATCGTTTACACAGGCGCCATTGAACGGATAC
CAATACCCTCGGATTGTTACAGTCGGTAATGCCGACCCTCAGTCTATTTTGATTGAAGGTCACGCGATGTGTGAC
ATGTATAATGCCGCCGAAGGCGAATACCGTGGGAGTAACGAAGCCCAGGATATCACACGAGACACAGACGCCTTT
TATAGAAAACTATGGAAACTGGCATTGTCTGGAGCCTACGATGATACTTCTGCAACTTACACAAATGCCGTTGCA
ATCTCGGAATATTTGGATTATGAAGTTGTGCATAATGACAGCTTGTTGGAAAGTCTGAACCACGCCGACATCATC
CGTGCTCGCTCGCTGGCGGACCAGTACGCATGGAGCACCAACAGCCAACAATCATCTTCCAGCGGGTCTGCGATC
AGAGTAGCTAGCCCAATTGCCGGGCAGACATTGGCATCGAGCATTCTAGAAGCCTTCGATCTGAACATCCAGGCA
AGTGGCACCCGGCAGAAGATGACTCTGTTGTTCGGCGGTGATGAGCCAGCTGTTGCCCTGTCGTCTCTGTTGGGA
CTCGCAAACCAGCATCAACCCAACTTTTTCTCCCGCTTGGTACGAGGTGGCTCATTTGTTTTCGAGCTGTACAGC
TACGAGAACAGCAGCAACTTGTACCCAACATACCCTGGGATGGACAATTTGTACGTGAGATTCTTGCTTCACAAT
GGGACCGACAACACCACCGACTTCGAAATGTATTCCCTCTTTGGACACGGCCCTAGTCGTGCGTCAATCCCATAT
ACTGAGTTTCATTCCGAGCTGGAGACATTTGCGCTGGCATCAACCGAAGAATGGTGCCTACGCTGCAACGCTGAA
ACTGTGTTCTGCAATGGAGTGTTAGACCAGACCGTATCTCAGCCGAAGAAGAATAGAGGTTTGGCTCCCGCTGTA
GCCGGAGTCATTGGTGCTGTTACAACGCTCGCTGTCATTGGACTTACAGCAGTCATTGTGTTCCTCATATGTCGT
GCTCGCAAGGGAAGATACCCCAAGAAAGGAAGCTTGGGAGGGTTCAAAGGTCCTAGTAAACTTGCCAGTGATACC
GATTTGTCGTTCAGTGAACCCATATGGGGAAACTCCAAGACTGATAGTACGCAAGCATCCAGTGGTCTCGCCGCT
GGAGTTGGAGTGGCTGTACAGGGACATGAACGTACCGGAAGCTGGGAGATGAGGCAGGGAAAAAAAGAGATTGGG
AATATTGAACCCGATGGCATGGAAGTGATGTCACCTTCTGAGGAAAATGGGGAGTATTGGGGTGTACACAGTGGC
CTTCAACCTGTGAAAATCCGGGAGAGTGTATAG
Transcript >Pro_DTO377G3_2|g199.t1
ATGGTCTCTGCCCAAGACTCCCAATCCATCCAGAAAGTATGGGGAGTCTTTGCATTTACCGTCTACGGAGACAGC
AAGCCCAGTGAGCTCACCAGCTCTCGAACATTGACCGACTACGGAGCCAACGAACTCGCCACGGCAGCATCGGAT
TTCCGTTATCGTTATGTGTCTGGAGGCTCTAATACTATAATCCAGAACATATCCCCAATAATTTTGGACTCAAAC
GATGTGGTTGTGCTCTCGGCAACGGATCAGAACATTGTTGGTTCCGCCCAAGCCTTCATGCAGGGTCTATACCCA
CCATTGGGCTCAATGAACATACCGAGCAGCCAAATTGCGAACGGATCGTTTACACAGGCGCCATTGAACGGATAC
CAATACCCTCGGATTGTTACAGTCGGTAATGCCGACCCTCAGTCTATTTTGATTGAAGGTCACGCGATGTGTGAC
ATGTATAATGCCGCCGAAGGCGAATACCGTGGGAGTAACGAAGCCCAGGATATCACACGAGACACAGACGCCTTT
TATAGAAAACTATGGAAACTGGCATTGTCTGGAGCCTACGATGATACTTCTGCAACTTACACAAATGCCGTTGCA
ATCTCGGAATATTTGGATTATGAAGTTGTGCATAATGACAGCTTGTTGGAAAGTCTGAACCACGCCGACATCATC
CGTGCTCGCTCGCTGGCGGACCAGTACGCATGGAGCACCAACAGCCAACAATCATCTTCCAGCGGGTCTGCGATC
AGAGTAGCTAGCCCAATTGCCGGGCAGACATTGGCATCGAGCATTCTAGAAGCCTTCGATCTGAACATCCAGGCA
AGTGGCACCCGGCAGAAGATGACTCTGTTGTTCGGCGGTGATGAGCCAGCTGTTGCCCTGTCGTCTCTGTTGGGA
CTCGCAAACCAGCATCAACCCAACTTTTTCTCCCGCTTGGTACGAGGTGGCTCATTTGTTTTCGAGCTGTACAGC
TACGAGAACAGCAGCAACTTGTACCCAACATACCCTGGGATGGACAATTTGTACGTGAGATTCTTGCTTCACAAT
GGGACCGACAACACCACCGACTTCGAAATGTATTCCCTCTTTGGACACGGCCCTAGTCGTGCGTCAATCCCATAT
ACTGAGTTTCATTCCGAGCTGGAGACATTTGCGCTGGCATCAACCGAAGAATGGTGCCTACGCTGCAACGCTGAA
ACTGTGTTCTGCAATGGAGTGTTAGACCAGACCGTATCTCAGCCGAAGAAGAATAGAGGTTTGGCTCCCGCTGTA
GCCGGAGTCATTGGTGCTGTTACAACGCTCGCTGTCATTGGACTTACAGCAGTCATTGTGTTCCTCATATGTCGT
GCTCGCAAGGGAAGATACCCCAAGAAAGGAAGCTTGGGAGGGTTCAAAGGTCCTAGTAAACTTGCCAGTGATACC
GATTTGTCGTTCAGTGAACCCATATGGGGAAACTCCAAGACTGATAGTACGCAAGCATCCAGTGGTCTCGCCGCT
GGAGTTGGAGTGGCTGTACAGGGACATGAACGTACCGGAAGCTGGGAGATGAGGCAGGGAAAAAAAGAGATTGGG
AATATTGAACCCGATGGCATGGAAGTGATGTCACCTTCTGAGGAAAATGGGGAGTATTGGGGTGTACACAGTGGC
CTTCAACCTGTGAAAATCCGGGAGAGTGTATAG
Gene >Pro_DTO377G3_2|g199.t1
ATGGTCTCTGCCCAAGACTCCCAATCCATCCAGAAAGTATGGGGAGTCTTTGCATTTACCGTCTACGGAGACAGC
AAGCCCAGTGAGCTCACCAGCTCTCGAACATTGACCGACTACGGAGCCAACGAACTCGCCACGGCAGCATCGGAT
TTCCGTTATCGTTATGTGTCTGGAGGCTCTAATACTATAATCCAGAACATATCCCCAATAATTTTGGACTCAAAC
GATGTGGTTGTGCTCTCGGCAACGGATCAGAACATTGTTGGTTCCGCCCAAGCCTTCATGCAGGGTCTATACCCA
CCATTGGGCTCAATGAACATACCGAGCAGCCAAATTGCGAACGGATCGTTTACACAGGCGCCATTGAACGGATAC
CAATACCCTCGGATTGTTACAGTCGGTAATGCCGACCCTCAGTCTATTTTGATTGAAGGTCACGCGATGTGTGAC
ATGTATAATGCCGCCGAAGGCGAATACCGTGGGAGTAACGAAGCCCAGGATATCACACGAGACACAGACGCCTTT
TATAGAAAACTATGGAAACTGGCATTGTCTGGAGCCTACGATGATACTTCTGCAACTTACACAAATGCCGTTGCA
ATCTCGGAATATTTGGATTATGAAGTTGTGCATAATGACAGCTTGTTGGAAAGTCTGAACCACGCCGACATCATC
CGTGCTCGCTCGCTGGCGGACCAGTACGCATGGAGCACCAACAGCCAACAATCATCTTCCAGCGGGTCTGCGATC
AGAGTAGCTAGCCCAATTGCCGGGCAGACATTGGCATCGAGCATTCTAGAAGCCTTCGATCTGAACATCCAGGCA
AGTGGCACCCGGCAGAAGATGACTCTGTTGTTCGGCGGTGATGAGCCAGCTGTTGCCCTGTCGTCTCTGTTGGGA
CTCGCAAACCAGCATCAACCCAACTTTTTCTCCCGCTTGGTACGAGGTGGCTCATTTGTTTTCGAGCTGTACAGC
TACGAGAACAGCAGCAACTTGTACCCAACATACCCTGGGATGGACAATTTGTACGTGAGATTCTTGCTTCACAAT
GGGACCGACAACACCACCGACTTCGAAATGTATTCCCTCTTTGGACACGGCCCTAGTCGTGCGTCAATCCCATAT
ACTGAGTTTCATTCCGAGCTGGAGACATTTGCGCTGGCATCAACCGAAGAATGGTGCCTACGCTGCAACGCTGAA
ACTGTGTTCTGCAATGGAGTGTTAGACCAGACCGTATCTCAGCCGAAGAAGAATAGAGGTTTGGCTCCCGCTGTA
GCCGGAGTCATTGGTGCTGTTACAACGCTCGCTGTCATTGGACTTACAGCAGTCATTGTGTTCCTCATATGTCGT
GCTCGCAAGGGAAGATACCCCAAGAAAGGAAGCTTGGGAGGGTTCAAAGGTCCTAGTAAACTTGCCAGTGATACC
GATTTGTCGTTCAGTGAACCCATATGGGGAAACTCCAAGACTGATAGTACGCAAGCATCCAGTGGTCTCGCCGCT
GGAGTTGGAGTGGCTGTACAGGGACATGAACGTACCGGAAGCTGGGAGATGAGGCAGGGAAAAAAAGAGATTGGG
AATATTGAACCCGATGGCATGGAAGTGATGTCACCTTCTGAGGAAAATGGGGAGTATTGGGGTGTACACAGTGGC
CTTCAACCTGTGAAAATCCGGGAGAGTGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail