Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1978.t1
Gene name
Locationscaffold_02:1335312..1337667
Strand-
Gene length (bp)2355
Transcript length (bp)2232
Coding sequence length (bp)2232
Protein length (aa) 744

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05557 MAD Mitotic checkpoint protein 6.2E-49 43 655

GO

GO Term Description Terminal node
GO:0007094 mitotic spindle assembly checkpoint Yes
GO:1901987 regulation of cell cycle phase transition No
GO:1902099 regulation of metaphase/anaphase transition of cell cycle No
GO:0007093 mitotic cell cycle checkpoint No
GO:0007088 regulation of mitotic nuclear division No
GO:1903047 mitotic cell cycle process No
GO:0010948 negative regulation of cell cycle process No
GO:0030071 regulation of mitotic metaphase/anaphase transition No
GO:0071173 spindle assembly checkpoint No
GO:0031577 spindle checkpoint No
GO:0033047 regulation of mitotic sister chromatid segregation No
GO:0045786 negative regulation of cell cycle No
GO:0007346 regulation of mitotic cell cycle No
GO:0050794 regulation of cellular process No
GO:0033045 regulation of sister chromatid segregation No
GO:2001251 negative regulation of chromosome organization No
GO:1905819 negative regulation of chromosome separation No
GO:0010639 negative regulation of organelle organization No
GO:0051983 regulation of chromosome segregation No
GO:2000816 negative regulation of mitotic sister chromatid separation No
GO:0065007 biological regulation No
GO:1901988 negative regulation of cell cycle phase transition No
GO:1902100 negative regulation of metaphase/anaphase transition of cell cycle No
GO:0050789 regulation of biological process No
GO:0000075 cell cycle checkpoint No
GO:0051129 negative regulation of cellular component organization No
GO:0048519 negative regulation of biological process No
GO:0045839 negative regulation of mitotic nuclear division No
GO:1901990 regulation of mitotic cell cycle phase transition No
GO:0010564 regulation of cell cycle process No
GO:0051784 negative regulation of nuclear division No
GO:0051726 regulation of cell cycle No
GO:0033044 regulation of chromosome organization No
GO:0051783 regulation of nuclear division No
GO:0071174 mitotic spindle checkpoint No
GO:0008150 biological_process No
GO:0045841 negative regulation of mitotic metaphase/anaphase transition No
GO:0009987 cellular process No
GO:0033043 regulation of organelle organization No
GO:1901991 negative regulation of mitotic cell cycle phase transition No
GO:0033046 negative regulation of sister chromatid segregation No
GO:0022402 cell cycle process No
GO:0045930 negative regulation of mitotic cell cycle No
GO:0010965 regulation of mitotic sister chromatid separation No
GO:0051985 negative regulation of chromosome segregation No
GO:0033048 negative regulation of mitotic sister chromatid segregation No
GO:0048523 negative regulation of cellular process No
GO:1905818 regulation of chromosome separation No
GO:0051128 regulation of cellular component organization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1978.t1
MDHSQNNRPASQLVAGFGSPPTPSGSRSSMRRSTTMRQSGRFTQSQAQSHQLIHDAEKDELRVQLSTLKYELENI
KQERELEALRHEKEIRDLQLKADADFRKAQTAESSSNRATHKSDELAKELKEIQDQALNDKLAFERKIRGLQDDN
QNLQEEFDDTQARLSDQERQFKYQINELETVRASLQKTIEEFQTDIQNARTSQESTQEKLSQREAEVAELEAENI
RLKAEGNDAEVLAVLKRELSEQVHHIRELESANRDQTTELRHLRKVSKNVEVVEEQKRSVENQLQLMKGIEAELN
TVQIQKQILEDERQSWVSLLQENEQPAEFDSPDAIVRAVVQGRIEIATLLDRLGTVDAQFLEKDEAIKSLENDKN
NLQRELEKLRVAGAASAGGPVAAESRLRARLERQRALAVKEVEYLRAQLKTFDAEEATMNEDQSQFDEQKSEQIT
QLQQLVDEYRSELHKVHEELSKQEATPKEEARGVKRALSPTNSEAESERIAVLSRKNRKLQEHLTKSDQATTLAR
RELDAAKSQIKSLKAKSRTRILELRDNPTAQTEQIKMTTLATLQSANRDLMAQLRGGRTDVKFVPVSTVESIKLE
MQDMERIVADKEKRMRRLKEIWTAKSSEFREAVASLLGFKLDFLPNGRVRVTSMFHLSSAYRHGDCDAPSDSGPG
SMGNGEENSIVFDGENGTMKISGGPNSLFAMELKPLIKFWVEERKDIPCFLAAMTLDFYDKTTRAARM*
Coding >Pro_DTO377G3_2|g1978.t1
ATGGACCATAGCCAGAATAACCGACCAGCTTCCCAGCTTGTTGCTGGATTCGGCTCACCCCCAACACCCTCCGGT
TCACGGAGCAGCATGCGCCGATCGACTACTATGCGACAATCCGGCCGTTTCACACAATCTCAAGCCCAGTCCCAT
CAACTTATTCATGATGCGGAAAAAGATGAGCTACGCGTGCAATTGAGCACACTCAAATACGAGCTCGAGAATATC
AAACAGGAACGAGAGTTGGAGGCTCTTCGCCATGAAAAAGAGATTCGCGACCTGCAACTGAAAGCGGATGCGGAT
TTTCGAAAGGCTCAGACTGCCGAATCTTCGAGTAATCGGGCCACCCATAAGAGCGACGAACTCGCAAAGGAATTG
AAAGAAATTCAGGACCAGGCCTTGAATGACAAACTTGCGTTTGAGCGCAAAATTAGAGGCCTTCAGGATGATAAT
CAGAACTTGCAGGAAGAGTTTGACGACACTCAGGCTCGACTTTCCGACCAGGAACGGCAATTCAAATACCAGATC
AACGAATTAGAGACAGTCCGCGCTTCTCTACAAAAGACCATCGAGGAATTCCAGACCGATATTCAAAATGCCAGG
ACATCGCAGGAATCAACGCAGGAGAAATTGTCTCAGCGTGAAGCCGAGGTCGCCGAGCTCGAAGCGGAAAATATT
CGATTGAAGGCCGAAGGGAACGATGCCGAGGTTTTGGCTGTATTAAAGAGAGAACTTTCCGAGCAAGTCCATCAT
ATTCGGGAATTGGAGTCAGCAAACCGTGATCAAACAACGGAGCTACGTCACCTTCGAAAAGTTTCGAAGAATGTT
GAAGTCGTCGAAGAACAAAAGAGATCAGTGGAGAACCAGCTCCAATTGATGAAGGGCATTGAAGCCGAACTCAAT
ACAGTTCAGATCCAGAAGCAGATCTTAGAAGATGAGCGACAATCTTGGGTCAGTCTTTTGCAGGAAAACGAGCAG
CCTGCAGAATTTGACTCACCAGATGCCATCGTGAGGGCGGTAGTTCAAGGACGAATTGAGATCGCTACGCTCCTT
GACCGTCTCGGAACTGTTGATGCCCAATTCCTTGAGAAGGACGAGGCTATCAAGAGCCTCGAAAATGATAAAAAT
AATCTGCAACGGGAGTTGGAGAAACTCCGCGTTGCGGGTGCCGCTTCTGCAGGAGGACCGGTCGCCGCGGAGAGC
CGGCTTCGAGCTCGACTGGAGCGTCAGCGTGCGCTTGCAGTGAAAGAAGTTGAATACCTGCGCGCACAACTTAAG
ACATTTGATGCGGAAGAGGCTACAATGAACGAAGATCAGTCGCAGTTTGATGAACAAAAATCCGAACAAATAACC
CAGCTGCAACAACTCGTCGATGAATATCGCAGTGAGCTTCACAAAGTTCATGAAGAGCTCTCCAAGCAGGAAGCT
ACACCGAAAGAAGAGGCGAGAGGCGTCAAACGAGCTCTTTCTCCGACTAACAGCGAAGCCGAAAGCGAGCGTATC
GCTGTGCTCAGCCGCAAGAACCGCAAGCTCCAGGAACATCTCACCAAATCAGACCAGGCCACGACTCTCGCTCGC
CGGGAACTGGATGCGGCCAAATCACAGATTAAGTCTTTGAAGGCCAAGTCACGAACACGCATTCTTGAACTGCGC
GATAATCCGACGGCCCAAACCGAGCAAATCAAGATGACTACTCTTGCAACCCTCCAGTCTGCAAACAGAGATCTA
ATGGCACAGCTGCGCGGGGGCCGTACCGATGTCAAATTTGTCCCGGTCAGCACCGTGGAGAGCATCAAGCTCGAA
ATGCAAGACATGGAGCGCATCGTTGCCGACAAAGAAAAGCGTATGCGCCGATTGAAGGAGATCTGGACAGCTAAG
TCCTCTGAGTTCCGGGAAGCCGTCGCCTCTCTTCTCGGCTTCAAGCTTGATTTCTTGCCGAATGGTAGAGTGCGA
GTCACTTCCATGTTTCACCTTTCCTCCGCTTATCGGCACGGCGACTGCGATGCACCTTCTGACTCTGGTCCTGGC
AGCATGGGCAATGGGGAAGAAAATTCTATCGTTTTCGATGGCGAGAACGGCACCATGAAGATATCGGGCGGACCG
AATAGTCTGTTTGCCATGGAACTTAAACCTCTCATCAAATTCTGGGTGGAAGAAAGAAAGGATATTCCATGTTTC
CTGGCGGCCATGACGTTGGACTTCTATGATAAGACCACCCGCGCTGCTAGGATGTGA
Transcript >Pro_DTO377G3_2|g1978.t1
ATGGACCATAGCCAGAATAACCGACCAGCTTCCCAGCTTGTTGCTGGATTCGGCTCACCCCCAACACCCTCCGGT
TCACGGAGCAGCATGCGCCGATCGACTACTATGCGACAATCCGGCCGTTTCACACAATCTCAAGCCCAGTCCCAT
CAACTTATTCATGATGCGGAAAAAGATGAGCTACGCGTGCAATTGAGCACACTCAAATACGAGCTCGAGAATATC
AAACAGGAACGAGAGTTGGAGGCTCTTCGCCATGAAAAAGAGATTCGCGACCTGCAACTGAAAGCGGATGCGGAT
TTTCGAAAGGCTCAGACTGCCGAATCTTCGAGTAATCGGGCCACCCATAAGAGCGACGAACTCGCAAAGGAATTG
AAAGAAATTCAGGACCAGGCCTTGAATGACAAACTTGCGTTTGAGCGCAAAATTAGAGGCCTTCAGGATGATAAT
CAGAACTTGCAGGAAGAGTTTGACGACACTCAGGCTCGACTTTCCGACCAGGAACGGCAATTCAAATACCAGATC
AACGAATTAGAGACAGTCCGCGCTTCTCTACAAAAGACCATCGAGGAATTCCAGACCGATATTCAAAATGCCAGG
ACATCGCAGGAATCAACGCAGGAGAAATTGTCTCAGCGTGAAGCCGAGGTCGCCGAGCTCGAAGCGGAAAATATT
CGATTGAAGGCCGAAGGGAACGATGCCGAGGTTTTGGCTGTATTAAAGAGAGAACTTTCCGAGCAAGTCCATCAT
ATTCGGGAATTGGAGTCAGCAAACCGTGATCAAACAACGGAGCTACGTCACCTTCGAAAAGTTTCGAAGAATGTT
GAAGTCGTCGAAGAACAAAAGAGATCAGTGGAGAACCAGCTCCAATTGATGAAGGGCATTGAAGCCGAACTCAAT
ACAGTTCAGATCCAGAAGCAGATCTTAGAAGATGAGCGACAATCTTGGGTCAGTCTTTTGCAGGAAAACGAGCAG
CCTGCAGAATTTGACTCACCAGATGCCATCGTGAGGGCGGTAGTTCAAGGACGAATTGAGATCGCTACGCTCCTT
GACCGTCTCGGAACTGTTGATGCCCAATTCCTTGAGAAGGACGAGGCTATCAAGAGCCTCGAAAATGATAAAAAT
AATCTGCAACGGGAGTTGGAGAAACTCCGCGTTGCGGGTGCCGCTTCTGCAGGAGGACCGGTCGCCGCGGAGAGC
CGGCTTCGAGCTCGACTGGAGCGTCAGCGTGCGCTTGCAGTGAAAGAAGTTGAATACCTGCGCGCACAACTTAAG
ACATTTGATGCGGAAGAGGCTACAATGAACGAAGATCAGTCGCAGTTTGATGAACAAAAATCCGAACAAATAACC
CAGCTGCAACAACTCGTCGATGAATATCGCAGTGAGCTTCACAAAGTTCATGAAGAGCTCTCCAAGCAGGAAGCT
ACACCGAAAGAAGAGGCGAGAGGCGTCAAACGAGCTCTTTCTCCGACTAACAGCGAAGCCGAAAGCGAGCGTATC
GCTGTGCTCAGCCGCAAGAACCGCAAGCTCCAGGAACATCTCACCAAATCAGACCAGGCCACGACTCTCGCTCGC
CGGGAACTGGATGCGGCCAAATCACAGATTAAGTCTTTGAAGGCCAAGTCACGAACACGCATTCTTGAACTGCGC
GATAATCCGACGGCCCAAACCGAGCAAATCAAGATGACTACTCTTGCAACCCTCCAGTCTGCAAACAGAGATCTA
ATGGCACAGCTGCGCGGGGGCCGTACCGATGTCAAATTTGTCCCGGTCAGCACCGTGGAGAGCATCAAGCTCGAA
ATGCAAGACATGGAGCGCATCGTTGCCGACAAAGAAAAGCGTATGCGCCGATTGAAGGAGATCTGGACAGCTAAG
TCCTCTGAGTTCCGGGAAGCCGTCGCCTCTCTTCTCGGCTTCAAGCTTGATTTCTTGCCGAATGGTAGAGTGCGA
GTCACTTCCATGTTTCACCTTTCCTCCGCTTATCGGCACGGCGACTGCGATGCACCTTCTGACTCTGGTCCTGGC
AGCATGGGCAATGGGGAAGAAAATTCTATCGTTTTCGATGGCGAGAACGGCACCATGAAGATATCGGGCGGACCG
AATAGTCTGTTTGCCATGGAACTTAAACCTCTCATCAAATTCTGGGTGGAAGAAAGAAAGGATATTCCATGTTTC
CTGGCGGCCATGACGTTGGACTTCTATGATAAGACCACCCGCGCTGCTAGGATGTGA
Gene >Pro_DTO377G3_2|g1978.t1
ATGGACCATAGCCAGAATAACCGACCAGCTTCCCAGCTTGTTGCTGGATTCGGCTCACCCCCAACACCCTCCGGT
TCACGGAGCAGCATGCGCCGATCGACTACTATGCGACAATCCGGCCGTTTCACACAATCTCAAGCCCAGTCCCAT
CAACTTATTCATGGTGAGACGATACCCTGCTCAGATAAAGTCGAGATGCCTTCGACGGATACCTGACTGGCCCGT
CTAGATGCGGAAAAAGATGAGCTACGCGTGCAATTGAGCACACTCAAATACGAGCTCGAGAATATCAAACAGGAA
CGAGAGTTGGAGGCTCTTCGCCATGAAAAAGAGATTCGCGACCTGCAACTGAAAGCGGATGCGGATTTTCGAAAG
GCTCAGGTGAGCTGCTACAAAATTTTCGTTTTCACGAGGTCAAACTGACAATATTTGCTGCAGACTGCCGAATCT
TCGAGTAATCGGGCCACCCATAAGAGCGACGAACTCGCAAAGGAATTGAAAGAAATTCAGGACCAGGCCTTGAAT
GACAAACTTGCGTTTGAGCGCAAAATTAGAGGCCTTCAGGATGATAATCAGAACTTGCAGGAAGAGTTTGACGAC
ACTCAGGCTCGACTTTCCGACCAGGAACGGCAATTCAAATACCAGATCAACGAATTAGAGACAGTCCGCGCTTCT
CTACAAAAGACCATCGAGGAATTCCAGACCGATATTCAAAATGCCAGGACATCGCAGGAATCAACGCAGGAGAAA
TTGTCTCAGCGTGAAGCCGAGGTCGCCGAGCTCGAAGCGGAAAATATTCGATTGAAGGCCGAAGGGAACGATGCC
GAGGTTTTGGCTGTATTAAAGAGAGAACTTTCCGAGCAAGTCCATCATATTCGGGAATTGGAGTCAGCAAACCGT
GATCAAACAACGGAGCTACGTCACCTTCGAAAAGTTTCGAAGAATGTTGAAGTCGTCGAAGAACAAAAGAGATCA
GTGGAGAACCAGCTCCAATTGATGAAGGGCATTGAAGCCGAACTCAATACAGTTCAGATCCAGAAGCAGATCTTA
GAAGATGAGCGACAATCTTGGGTCAGTCTTTTGCAGGAAAACGAGCAGCCTGCAGAATTTGACTCACCAGATGCC
ATCGTGAGGGCGGTAGTTCAAGGACGAATTGAGATCGCTACGCTCCTTGACCGTCTCGGAACTGTTGATGCCCAA
TTCCTTGAGAAGGACGAGGCTATCAAGAGCCTCGAAAATGATAAAAATAATCTGCAACGGGAGTTGGAGAAACTC
CGCGTTGCGGGTGCCGCTTCTGCAGGAGGACCGGTCGCCGCGGAGAGCCGGCTTCGAGCTCGACTGGAGCGTCAG
CGTGCGCTTGCAGTGAAAGAAGTTGAATACCTGCGCGCACAACTTAAGACATTTGATGCGGAAGAGGCTACAATG
AACGAAGATCAGTCGCAGTTTGATGAACAAAAATCCGAACAAATAACCCAGCTGCAACAACTCGTCGATGAATAT
CGCAGTGAGCTTCACAAAGTTCATGAAGAGCTCTCCAAGCAGGAAGCTACACCGAAAGAAGAGGCGAGAGGCGTC
AAACGAGCTCTTTCTCCGACTAACAGCGAAGCCGAAAGCGAGCGTATCGCTGTGCTCAGCCGCAAGAACCGCAAG
CTCCAGGAACATCTCACCAAATCAGACCAGGCCACGACTCTCGCTCGCCGGGAACTGGATGCGGCCAAATCACAG
ATTAAGTCTTTGAAGGCCAAGTCACGAACACGCATTCTTGAACTGCGCGATAATCCGACGGCCCAAACCGAGCAA
ATCAAGATGACTACTCTTGCAACCCTCCAGTCTGCAAACAGAGATCTAATGGCACAGCTGCGCGGGGGCCGTACC
GATGTCAAATTTGTCCCGGTCAGCACCGTGGAGAGCATCAAGCTCGAAATGCAAGACATGGAGCGCATCGTTGCC
GACAAAGAAAAGCGTATGCGCCGATTGAAGGAGATCTGGACAGCTAAGTCCTCTGAGTTCCGGGAAGCCGTCGCC
TCTCTTCTCGGCTTCAAGCTTGATTTCTTGCCGAATGGTAGAGTGCGAGTCACTTCCATGTTTCACCTTTCCTCC
GCTTATCGGCACGGCGACTGCGATGCACCTTCTGACTCTGGTCCTGGCAGCATGGGCAATGGGGAAGAAAATTCT
ATCGTTTTCGATGGCGAGAACGGCACCATGAAGATATCGGGCGGACCGAATAGTCTGTTTGCCATGGAACTTAAA
CCTCTCATCAAATTCTGGGTGGAAGAAAGAAAGGATATTCCATGTTTCCTGGCGGCCATGACGTTGGACTTCTAT
GATAAGACCACCCGCGCTGCTAGGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail