Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1968.t1
Gene name
Locationscaffold_02:1312344..1314726
Strand+
Gene length (bp)2382
Transcript length (bp)2334
Coding sequence length (bp)2334
Protein length (aa) 778

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 8.0E-175 40 769

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 40 62 22
2 66 88 22
3 101 123 22
4 152 174 22
5 257 279 22
6 352 374 22
7 453 472 19
8 477 499 22
9 571 593 22
10 626 648 22
11 748 770 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1968.t1
MDGNVPEQRQRTVGGPSLDQPPTDPIADPAQARATSPQSFTPRSLLVGLIIGALITFSNTYFGLQTGWISTMAMP
SALIGFSVFKVLSKHLSFPFTPVENVLIQTVAGAVGTMPLGCGFVGVIPALEFLLKPGEDGPEGDGGEGEGGPLK
LGFWKLVIWSLGVCLFGVVFAVPLRKAVIVREKLRFPSGTASALMLKVLHSSGSEEKVIAPESSRAGIFNTEAET
AGPSQEDTGLLKDGDAEDQASKEQNWRSKMRILLGSFTVSGAYTLFSYFVPLVRAIPLFGVGMADNWLWTLNPSP
AYIGQGIIMGPSTCMHMLFGAVLGWGVLSPLAKSRGWAPGPVNNWEDGSKAWIVWISLAIMLADSLVSLGWLVLR
PILKYSPRWIAYFRSTRAGQWIALRLHSSQHSYINYSALEPEPHLLAHEDVAQHTLVTANEEDKDDAPPSELIST
RTVVILLPLTLLLNVACMHFVFGDIISPFLSTLATLLAVLLSIMGVRALGETDLNPVSGISKLTQLLFSLATPAS
HFSRRTALVTNLLAGAVSESGALQAGDMMQDLKTGHLLGASPKAQFYGQIIGSLVGAVLSTAVYKLYVNVYEIPG
EMFQTPTAYVWIFTARLVTGQGLPKMAGQVSVIAGIVWAFLTALRIVAASPAFARNGKPPPWRCWIPGGIAVAVG
IFNEPSFTLARAIGGIIAWWWSRRHSESLNQQVDSGNATTMGSSLETELQDAQRSSISAEQASEKADAASSTVVV
LASGLILGEGIMSIVNLLLASGRVPHL*
Coding >Pro_DTO377G3_2|g1968.t1
ATGGACGGCAATGTCCCCGAACAGCGTCAGCGCACTGTGGGAGGGCCGTCCCTGGATCAGCCGCCCACAGATCCT
ATCGCTGATCCCGCGCAAGCTCGCGCCACATCCCCTCAGAGCTTCACTCCACGCTCACTTCTCGTCGGTCTTATT
ATTGGTGCTCTCATCACATTCTCGAATACCTATTTCGGCTTGCAGACAGGATGGATCAGCACAATGGCAATGCCC
TCGGCCTTGATTGGCTTTTCGGTCTTCAAGGTTCTATCCAAGCACCTGTCTTTCCCCTTCACACCGGTTGAGAAT
GTCTTGATACAAACGGTTGCCGGTGCAGTGGGAACTATGCCCCTTGGATGCGGATTTGTTGGCGTTATCCCTGCC
CTGGAGTTTCTGTTGAAGCCTGGCGAAGATGGACCCGAAGGCGATGGCGGAGAAGGCGAAGGAGGTCCTTTGAAA
CTCGGTTTCTGGAAGTTGGTTATCTGGAGTCTGGGAGTCTGTCTCTTCGGGGTGGTGTTTGCGGTCCCACTACGA
AAAGCGGTCATCGTCCGAGAGAAGCTGCGATTTCCGAGTGGTACTGCCTCGGCGTTGATGCTCAAGGTCTTGCAT
AGTTCTGGTAGCGAGGAAAAGGTTATAGCACCAGAAAGTTCCCGTGCGGGTATTTTTAACACGGAGGCCGAAACA
GCTGGTCCATCCCAAGAAGACACAGGCCTCTTGAAGGATGGCGATGCTGAAGACCAAGCTTCCAAGGAGCAAAAT
TGGCGCTCGAAGATGCGCATCTTACTTGGATCGTTTACAGTATCGGGTGCATATACTCTTTTCTCCTACTTCGTC
CCTCTAGTCCGTGCCATCCCTCTGTTTGGCGTGGGCATGGCGGATAACTGGCTGTGGACCCTCAACCCGTCGCCA
GCATATATCGGCCAGGGCATCATTATGGGTCCATCAACGTGCATGCACATGCTTTTCGGGGCAGTCTTGGGGTGG
GGCGTTCTATCACCGTTGGCTAAGAGCCGCGGCTGGGCTCCCGGCCCGGTTAATAACTGGGAAGATGGCAGCAAA
GCATGGATTGTCTGGATATCGCTAGCCATTATGCTTGCCGATTCACTTGTTAGTCTTGGGTGGCTGGTGCTCAGG
CCCATCCTGAAGTACTCTCCAAGATGGATAGCCTATTTTCGATCCACTCGTGCTGGTCAGTGGATTGCACTCCGA
CTACATTCTTCTCAGCACTCATATATCAACTACTCCGCTTTGGAGCCAGAGCCTCATCTTTTGGCTCATGAAGAT
GTCGCCCAACATACACTAGTAACTGCAAACGAAGAGGATAAGGATGATGCACCGCCATCTGAACTCATCTCAACT
CGAACAGTAGTGATTCTCCTTCCTTTGACTCTCCTCTTGAATGTCGCATGCATGCACTTTGTCTTTGGGGACATC
ATTTCCCCCTTTCTGTCGACATTGGCAACTCTGCTGGCAGTACTACTGTCTATTATGGGTGTCCGGGCTCTCGGC
GAGACCGACCTCAACCCAGTTTCGGGTATCAGCAAGCTGACACAACTTCTCTTTTCACTCGCCACGCCAGCATCC
CATTTCTCCAGACGCACCGCATTAGTGACGAACCTGCTTGCGGGTGCAGTCTCCGAGTCAGGAGCTCTGCAAGCC
GGTGATATGATGCAAGATTTAAAGACCGGTCATCTACTCGGCGCAAGCCCCAAGGCCCAGTTCTATGGCCAGATA
ATCGGCAGTCTTGTGGGTGCAGTTCTATCAACTGCCGTATACAAATTATACGTGAACGTATATGAGATCCCGGGC
GAAATGTTCCAGACACCTACCGCGTATGTCTGGATCTTCACTGCTCGCCTTGTGACCGGTCAAGGGCTGCCCAAA
ATGGCTGGACAAGTCTCTGTCATTGCTGGTATCGTGTGGGCATTCCTTACCGCCTTGAGGATCGTAGCTGCGTCC
CCTGCCTTTGCACGCAACGGGAAACCCCCTCCTTGGAGATGTTGGATCCCCGGCGGTATCGCTGTTGCCGTTGGT
ATCTTTAACGAGCCTTCCTTTACCCTGGCGAGAGCCATCGGTGGTATCATTGCATGGTGGTGGTCGCGGAGGCAC
TCTGAATCGCTCAACCAACAAGTGGACAGCGGAAACGCCACTACTATGGGATCGTCTCTGGAGACTGAATTACAG
GATGCGCAGCGATCATCAATATCAGCCGAACAGGCATCTGAAAAAGCAGATGCCGCCTCCTCGACTGTCGTCGTT
CTTGCCTCCGGCCTCATTTTGGGTGAAGGTATCATGAGCATTGTGAATCTTCTTCTTGCAAGTGGGCGCGTTCCA
CATCTCTGA
Transcript >Pro_DTO377G3_2|g1968.t1
ATGGACGGCAATGTCCCCGAACAGCGTCAGCGCACTGTGGGAGGGCCGTCCCTGGATCAGCCGCCCACAGATCCT
ATCGCTGATCCCGCGCAAGCTCGCGCCACATCCCCTCAGAGCTTCACTCCACGCTCACTTCTCGTCGGTCTTATT
ATTGGTGCTCTCATCACATTCTCGAATACCTATTTCGGCTTGCAGACAGGATGGATCAGCACAATGGCAATGCCC
TCGGCCTTGATTGGCTTTTCGGTCTTCAAGGTTCTATCCAAGCACCTGTCTTTCCCCTTCACACCGGTTGAGAAT
GTCTTGATACAAACGGTTGCCGGTGCAGTGGGAACTATGCCCCTTGGATGCGGATTTGTTGGCGTTATCCCTGCC
CTGGAGTTTCTGTTGAAGCCTGGCGAAGATGGACCCGAAGGCGATGGCGGAGAAGGCGAAGGAGGTCCTTTGAAA
CTCGGTTTCTGGAAGTTGGTTATCTGGAGTCTGGGAGTCTGTCTCTTCGGGGTGGTGTTTGCGGTCCCACTACGA
AAAGCGGTCATCGTCCGAGAGAAGCTGCGATTTCCGAGTGGTACTGCCTCGGCGTTGATGCTCAAGGTCTTGCAT
AGTTCTGGTAGCGAGGAAAAGGTTATAGCACCAGAAAGTTCCCGTGCGGGTATTTTTAACACGGAGGCCGAAACA
GCTGGTCCATCCCAAGAAGACACAGGCCTCTTGAAGGATGGCGATGCTGAAGACCAAGCTTCCAAGGAGCAAAAT
TGGCGCTCGAAGATGCGCATCTTACTTGGATCGTTTACAGTATCGGGTGCATATACTCTTTTCTCCTACTTCGTC
CCTCTAGTCCGTGCCATCCCTCTGTTTGGCGTGGGCATGGCGGATAACTGGCTGTGGACCCTCAACCCGTCGCCA
GCATATATCGGCCAGGGCATCATTATGGGTCCATCAACGTGCATGCACATGCTTTTCGGGGCAGTCTTGGGGTGG
GGCGTTCTATCACCGTTGGCTAAGAGCCGCGGCTGGGCTCCCGGCCCGGTTAATAACTGGGAAGATGGCAGCAAA
GCATGGATTGTCTGGATATCGCTAGCCATTATGCTTGCCGATTCACTTGTTAGTCTTGGGTGGCTGGTGCTCAGG
CCCATCCTGAAGTACTCTCCAAGATGGATAGCCTATTTTCGATCCACTCGTGCTGGTCAGTGGATTGCACTCCGA
CTACATTCTTCTCAGCACTCATATATCAACTACTCCGCTTTGGAGCCAGAGCCTCATCTTTTGGCTCATGAAGAT
GTCGCCCAACATACACTAGTAACTGCAAACGAAGAGGATAAGGATGATGCACCGCCATCTGAACTCATCTCAACT
CGAACAGTAGTGATTCTCCTTCCTTTGACTCTCCTCTTGAATGTCGCATGCATGCACTTTGTCTTTGGGGACATC
ATTTCCCCCTTTCTGTCGACATTGGCAACTCTGCTGGCAGTACTACTGTCTATTATGGGTGTCCGGGCTCTCGGC
GAGACCGACCTCAACCCAGTTTCGGGTATCAGCAAGCTGACACAACTTCTCTTTTCACTCGCCACGCCAGCATCC
CATTTCTCCAGACGCACCGCATTAGTGACGAACCTGCTTGCGGGTGCAGTCTCCGAGTCAGGAGCTCTGCAAGCC
GGTGATATGATGCAAGATTTAAAGACCGGTCATCTACTCGGCGCAAGCCCCAAGGCCCAGTTCTATGGCCAGATA
ATCGGCAGTCTTGTGGGTGCAGTTCTATCAACTGCCGTATACAAATTATACGTGAACGTATATGAGATCCCGGGC
GAAATGTTCCAGACACCTACCGCGTATGTCTGGATCTTCACTGCTCGCCTTGTGACCGGTCAAGGGCTGCCCAAA
ATGGCTGGACAAGTCTCTGTCATTGCTGGTATCGTGTGGGCATTCCTTACCGCCTTGAGGATCGTAGCTGCGTCC
CCTGCCTTTGCACGCAACGGGAAACCCCCTCCTTGGAGATGTTGGATCCCCGGCGGTATCGCTGTTGCCGTTGGT
ATCTTTAACGAGCCTTCCTTTACCCTGGCGAGAGCCATCGGTGGTATCATTGCATGGTGGTGGTCGCGGAGGCAC
TCTGAATCGCTCAACCAACAAGTGGACAGCGGAAACGCCACTACTATGGGATCGTCTCTGGAGACTGAATTACAG
GATGCGCAGCGATCATCAATATCAGCCGAACAGGCATCTGAAAAAGCAGATGCCGCCTCCTCGACTGTCGTCGTT
CTTGCCTCCGGCCTCATTTTGGGTGAAGGTATCATGAGCATTGTGAATCTTCTTCTTGCAAGTGGGCGCGTTCCA
CATCTCTGA
Gene >Pro_DTO377G3_2|g1968.t1
ATGGACGGCAATGTCCCCGAACAGCGTCAGCGCACTGTGGGAGGGCCGTCCCTGGATCAGCCGCCCACAGATCCT
ATCGCTGATCCCGCGCAAGCTCGCGCCACATCCCCTCAGAGCTTCACTCCACGCTCACTTCTCGTCGGTCTTATT
ATTGGTGCTCTCATCACATTCTCGAATACCTATTTCGGCTTGCAGACAGGATGGATCAGCACAATGGCAATGCCC
TCGGCCTTGATTGGCTTTTCGGTCTTCAAGGTTCTATCCAAGCACCTGTCTTTCCCCTTCACACCGGTTGAGAAT
GTCTTGATACAAACGGTTGCCGGTGCAGTGGGAACTATGCCCCTTGGATGCGGATTTGTTGGCGTTATCCCTGCC
CTGGAGTTTCTGTTGAAGCCTGGCGAAGATGGACCCGAAGGCGATGGCGGAGAAGGCGAAGGAGGTCCTTTGAAA
CTCGGTTTCTGGAAGTTGGTTATCTGGAGTCTGGGAGTCTGTCTCTTCGGGGTGGTGTTTGCGGTCCCACTACGA
AAAGCGGTCATCGTCCGAGAGAAGCTGCGATTTCCGAGTGGTACTGCCTCGGCGTTGATGCTCAAGGTCTTGCAT
AGTTCTGGTAGCGAGGAAAAGGTTATAGCACCAGAAAGTTCCCGTGCGGGTATTTTTAACACGGAGGCCGAAACA
GCTGGTCCATCCCAAGAAGACACAGGCCTCTTGAAGGATGGCGATGCTGAAGACCAAGCTTCCAAGGAGCAAAAT
TGGCGCTCGAAGATGCGCATCTTACTTGGATCGTTTACAGTATCGGGTGCATATGTGAATATCTCCAACTGGACT
CTGCAAAGTTCATGCTAACTCAATTAGACTCTTTTCTCCTACTTCGTCCCTCTAGTCCGTGCCATCCCTCTGTTT
GGCGTGGGCATGGCGGATAACTGGCTGTGGACCCTCAACCCGTCGCCAGCATATATCGGCCAGGGCATCATTATG
GGTCCATCAACGTGCATGCACATGCTTTTCGGGGCAGTCTTGGGGTGGGGCGTTCTATCACCGTTGGCTAAGAGC
CGCGGCTGGGCTCCCGGCCCGGTTAATAACTGGGAAGATGGCAGCAAAGCATGGATTGTCTGGATATCGCTAGCC
ATTATGCTTGCCGATTCACTTGTTAGTCTTGGGTGGCTGGTGCTCAGGCCCATCCTGAAGTACTCTCCAAGATGG
ATAGCCTATTTTCGATCCACTCGTGCTGGTCAGTGGATTGCACTCCGACTACATTCTTCTCAGCACTCATATATC
AACTACTCCGCTTTGGAGCCAGAGCCTCATCTTTTGGCTCATGAAGATGTCGCCCAACATACACTAGTAACTGCA
AACGAAGAGGATAAGGATGATGCACCGCCATCTGAACTCATCTCAACTCGAACAGTAGTGATTCTCCTTCCTTTG
ACTCTCCTCTTGAATGTCGCATGCATGCACTTTGTCTTTGGGGACATCATTTCCCCCTTTCTGTCGACATTGGCA
ACTCTGCTGGCAGTACTACTGTCTATTATGGGTGTCCGGGCTCTCGGCGAGACCGACCTCAACCCAGTTTCGGGT
ATCAGCAAGCTGACACAACTTCTCTTTTCACTCGCCACGCCAGCATCCCATTTCTCCAGACGCACCGCATTAGTG
ACGAACCTGCTTGCGGGTGCAGTCTCCGAGTCAGGAGCTCTGCAAGCCGGTGATATGATGCAAGATTTAAAGACC
GGTCATCTACTCGGCGCAAGCCCCAAGGCCCAGTTCTATGGCCAGATAATCGGCAGTCTTGTGGGTGCAGTTCTA
TCAACTGCCGTATACAAATTATACGTGAACGTATATGAGATCCCGGGCGAAATGTTCCAGACACCTACCGCGTAT
GTCTGGATCTTCACTGCTCGCCTTGTGACCGGTCAAGGGCTGCCCAAAATGGCTGGACAAGTCTCTGTCATTGCT
GGTATCGTGTGGGCATTCCTTACCGCCTTGAGGATCGTAGCTGCGTCCCCTGCCTTTGCACGCAACGGGAAACCC
CCTCCTTGGAGATGTTGGATCCCCGGCGGTATCGCTGTTGCCGTTGGTATCTTTAACGAGCCTTCCTTTACCCTG
GCGAGAGCCATCGGTGGTATCATTGCATGGTGGTGGTCGCGGAGGCACTCTGAATCGCTCAACCAACAAGTGGAC
AGCGGAAACGCCACTACTATGGGATCGTCTCTGGAGACTGAATTACAGGATGCGCAGCGATCATCAATATCAGCC
GAACAGGCATCTGAAAAAGCAGATGCCGCCTCCTCGACTGTCGTCGTTCTTGCCTCCGGCCTCATTTTGGGTGAA
GGTATCATGAGCATTGTGAATCTTCTTCTTGCAAGTGGGCGCGTTCCACATCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail