Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1967.t1
Gene name
Locationscaffold_02:1310055..1311559
Strand-
Gene length (bp)1504
Transcript length (bp)1452
Coding sequence length (bp)1452
Protein length (aa) 484

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01222 ERG4_ERG24 Ergosterol biosynthesis ERG4/ERG24 family 1.4E-137 46 483

GO

GO Term Description Terminal node
GO:0016628 oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor Yes
GO:0016020 membrane Yes
GO:0016126 sterol biosynthetic process Yes
GO:0003824 catalytic activity No
GO:0006629 lipid metabolic process No
GO:0008202 steroid metabolic process No
GO:0006694 steroid biosynthetic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0003674 molecular_function No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016125 sterol metabolic process No
GO:0016491 oxidoreductase activity No
GO:0110165 cellular anatomical entity No
GO:1901615 organic hydroxy compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 114 136 22
3 157 179 22
4 183 205 22
5 264 286 22
6 306 328 22
7 341 358 17
8 426 448 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1967.t1
MDDQVKSSKDGNPRVVDKPNSRADFKQAQLAGGWIPGMDTKVDYSDEFEFGGSLGNLALMIGFPLLMWYMWIGAT
YYDGKLPLPQNGQSWADFGKHLCHLVYIGAFPHFRAWRIYWTFYIFEAACYIFMPGFTCYGKPLRHLKGKQLEYY
CSAYSSLYFTMVVMAALHYTGMFPIYTILDDFGPLMSVAILSGFLASFFAYFSAFARGTQHRITGYPIYDFFMGA
ELNPRMFGILDFKMFYEVRIPWFMLLGLSCAAATRQYELYGYVSGEVMFLVMAHFLYANACAKAEHLITTTWDMY
QEKLGFLLIFWNMAGVPMSYCHCVLYLANRHPSTYAWNKNALAVLFVSYLCVYWVWDTANSQKNAFRMMERGKMV
TRNTFPQLPWRHVNNPKTLVTDDGDTIFVDGWYRLARKIHYSCDMFFALSWALITGFDSPLPWFYPVFFAVMIGH
RAMRDITKCKNKYGKTWDEYERQVPSLFIPYVL*
Coding >Pro_DTO377G3_2|g1967.t1
ATGGATGACCAAGTCAAGTCTTCAAAGGATGGCAACCCTCGGGTTGTTGACAAGCCAAATTCGCGCGCTGACTTC
AAGCAAGCGCAACTCGCTGGTGGATGGATACCCGGCATGGACACCAAAGTGGACTACTCAGATGAATTCGAATTC
GGTGGCTCACTCGGTAACTTGGCACTTATGATTGGCTTCCCATTGCTGATGTGGTACATGTGGATCGGTGCTACC
TACTATGACGGGAAACTACCTCTGCCGCAAAACGGACAGTCCTGGGCGGACTTCGGAAAGCATCTGTGTCACCTT
GTTTACATCGGTGCGTTTCCGCACTTTAGGGCGTGGCGCATCTACTGGACATTCTACATCTTCGAGGCAGCATGC
TACATCTTCATGCCTGGGTTCACGTGTTATGGGAAGCCTCTTCGCCATTTGAAAGGCAAGCAGCTGGAGTATTAT
TGCTCCGCTTACAGTAGCTTGTACTTCACAATGGTTGTCATGGCTGCTCTGCACTACACTGGAATGTTCCCAATC
TACACTATCCTAGATGATTTCGGTCCTCTGATGTCCGTGGCGATTTTGTCCGGGTTTCTCGCCAGCTTTTTCGCT
TATTTCTCTGCATTTGCTCGAGGTACCCAGCACCGCATCACTGGTTACCCAATCTATGATTTTTTCATGGGAGCA
GAACTCAACCCACGCATGTTCGGGATCCTGGACTTTAAGATGTTCTACGAAGTCCGTATCCCATGGTTCATGCTC
TTGGGTCTGAGCTGCGCAGCTGCCACTCGCCAATATGAACTCTACGGCTATGTCTCCGGTGAAGTTATGTTCCTT
GTCATGGCACACTTCCTTTACGCCAATGCCTGCGCCAAGGCAGAGCACCTCATCACCACAACATGGGACATGTAC
CAGGAGAAACTGGGATTCTTGTTGATCTTCTGGAACATGGCTGGCGTCCCTATGTCATATTGCCACTGCGTTCTG
TACCTGGCTAATCGTCACCCGTCAACATATGCATGGAACAAAAATGCATTGGCGGTATTGTTTGTGTCATATCTT
TGCGTCTACTGGGTCTGGGACACTGCAAACAGCCAGAAGAACGCCTTCCGCATGATGGAGCGAGGCAAAATGGTT
ACGCGCAATACCTTCCCCCAGCTTCCTTGGCGCCACGTTAACAATCCAAAGACACTTGTGACAGACGACGGCGAT
ACCATTTTCGTTGATGGGTGGTACCGATTGGCTCGCAAGATCCATTACAGTTGCGATATGTTTTTCGCTTTGTCG
TGGGCCCTAATCACCGGGTTCGACAGCCCCCTTCCCTGGTTCTACCCTGTCTTCTTCGCGGTTATGATCGGCCAC
CGAGCCATGAGGGATATCACCAAATGTAAAAACAAGTATGGGAAGACATGGGATGAGTATGAGAGGCAGGTTCCA
AGCCTCTTCATTCCGTATGTGCTCTAA
Transcript >Pro_DTO377G3_2|g1967.t1
ATGGATGACCAAGTCAAGTCTTCAAAGGATGGCAACCCTCGGGTTGTTGACAAGCCAAATTCGCGCGCTGACTTC
AAGCAAGCGCAACTCGCTGGTGGATGGATACCCGGCATGGACACCAAAGTGGACTACTCAGATGAATTCGAATTC
GGTGGCTCACTCGGTAACTTGGCACTTATGATTGGCTTCCCATTGCTGATGTGGTACATGTGGATCGGTGCTACC
TACTATGACGGGAAACTACCTCTGCCGCAAAACGGACAGTCCTGGGCGGACTTCGGAAAGCATCTGTGTCACCTT
GTTTACATCGGTGCGTTTCCGCACTTTAGGGCGTGGCGCATCTACTGGACATTCTACATCTTCGAGGCAGCATGC
TACATCTTCATGCCTGGGTTCACGTGTTATGGGAAGCCTCTTCGCCATTTGAAAGGCAAGCAGCTGGAGTATTAT
TGCTCCGCTTACAGTAGCTTGTACTTCACAATGGTTGTCATGGCTGCTCTGCACTACACTGGAATGTTCCCAATC
TACACTATCCTAGATGATTTCGGTCCTCTGATGTCCGTGGCGATTTTGTCCGGGTTTCTCGCCAGCTTTTTCGCT
TATTTCTCTGCATTTGCTCGAGGTACCCAGCACCGCATCACTGGTTACCCAATCTATGATTTTTTCATGGGAGCA
GAACTCAACCCACGCATGTTCGGGATCCTGGACTTTAAGATGTTCTACGAAGTCCGTATCCCATGGTTCATGCTC
TTGGGTCTGAGCTGCGCAGCTGCCACTCGCCAATATGAACTCTACGGCTATGTCTCCGGTGAAGTTATGTTCCTT
GTCATGGCACACTTCCTTTACGCCAATGCCTGCGCCAAGGCAGAGCACCTCATCACCACAACATGGGACATGTAC
CAGGAGAAACTGGGATTCTTGTTGATCTTCTGGAACATGGCTGGCGTCCCTATGTCATATTGCCACTGCGTTCTG
TACCTGGCTAATCGTCACCCGTCAACATATGCATGGAACAAAAATGCATTGGCGGTATTGTTTGTGTCATATCTT
TGCGTCTACTGGGTCTGGGACACTGCAAACAGCCAGAAGAACGCCTTCCGCATGATGGAGCGAGGCAAAATGGTT
ACGCGCAATACCTTCCCCCAGCTTCCTTGGCGCCACGTTAACAATCCAAAGACACTTGTGACAGACGACGGCGAT
ACCATTTTCGTTGATGGGTGGTACCGATTGGCTCGCAAGATCCATTACAGTTGCGATATGTTTTTCGCTTTGTCG
TGGGCCCTAATCACCGGGTTCGACAGCCCCCTTCCCTGGTTCTACCCTGTCTTCTTCGCGGTTATGATCGGCCAC
CGAGCCATGAGGGATATCACCAAATGTAAAAACAAGTATGGGAAGACATGGGATGAGTATGAGAGGCAGGTTCCA
AGCCTCTTCATTCCGTATGTGCTCTAA
Gene >Pro_DTO377G3_2|g1967.t1
ATGGATGACCAAGTCAAGTCTTCAAAGGATGGCAACCCTCGGGTTGTTGACAAGCCAAATTCGCGCGCTGACTTC
AAGCAAGCGCAACTCGCTGGTGGATGGATACCCGGCATGGACACCAAAGTGGACTACTCAGATGAATTCGAATTC
GGTGGCTCACTCGGTAACTTGGCACTTATGATTGGCTTCCCATTGCTGATGTGGTACATGTGGATCGGTGCTACC
TACTATGACGGGAAACTACCTCTGCCGCAAAACGGACAGTCCTGGGCGGACTTCGGAAAGCATCTGTGTCACCTT
GTTTACATCGGTGCGTTTCCGCACTTTAGGGCGTGGCGCATCTACTGGACATTCTACATCTTCGAGGCAGCATGC
TACATCTTCATGCCTGGGTTCACGTGTTATGGGAAGCCTCTTCGCCATTTGAAAGGCAAGCAGCTGGAGTATTAT
TGCTCCGCTTACAGTAGCTTGTACTTCACAATGGTTGTCATGGCTGCTCTGCACTACACTGGAATGTTCCCAATC
TACACTATCCTAGATGATTTCGGTCCTCTGATGTCCGTGGCGATTTTGTCCGGGTTTCTCGCCAGCTTTTTCGCT
TATTTCTCTGCATTTGCTCGAGGTACCCAGCACCGCATCACTGGTTACCCAATCTATGATTTTTTCATGGGAGCA
GAACTCAACCCACGCATGTTCGGGATCCTGGACTTTAAGATGTTCTACGAAGTCCGTATCCCATGGTTCATGCTC
TTGGGTCTGAGCTGCGCAGCTGCCACTCGCCAATATGAACTCTACGGCTATGTCTCCGGTGAAGTTATGTTCCTT
GTCATGGCACACTTCCTTTACGCCAATGCCTGCGCCAAGGCAGAGCACCTCATCACCACAACATGGGACATGTAC
CAGGAGAAACTGGGATTCTTGTTGATCTTCTGGAACATGGCTGGCGTCCCTATGTCATATTGCCACTGCGTTCTG
TACCTGGCTAATCGTCACCCGTCAACATATGCATGGAACAAAAATGCATTGGCGGTATTGTTTGTGTCATATCTT
TGCGTCTACTGGGTCTGGGACACTGCAAACAGCCAGAAGAACGCCTTCCGCATGATGGAGCGAGGCAAAATGGTT
ACGCGCAATACCTTCCCCCAGCTTCCTTGGCGCCACGTTAACAATCCAAAGACACTTGTGACAGACGACGGCGAT
ACCATTTTCGTTGATGGGTGGTACCGATTGGCTCGCAAGATCCATTACAGTTGCGATATGTTTTTCGCTTTGTCG
TGGGCCCTAATCACCGGGTTCGACAGCCCCCTTCCCTGGTTCTACCCTGTCTTCTTCGCGGTTATGATCGGCCAC
CGAGCCATGAGGGATATCACCAAATGTAAAAACAAGTATGGGAAGACATGGGATGAGTATGAGAGGCAGGTTCCA
AGCCTCTTCATTCCGGTGAGCTCTTACTACAACTTTCATTTTGAAACTATATACTCACTCTCAACAGTATGTGCT
CTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail