Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1962.t1
Gene name
Locationscaffold_02:1294899..1296477
Strand-
Gene length (bp)1578
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 3.0E-60 27 472
PF00324 AA_permease Amino acid permease 2.9E-32 42 481

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 62 93 31
3 114 136 22
4 151 173 22
5 182 201 19
6 221 243 22
7 263 285 22
8 311 333 22
9 366 388 22
10 392 414 22
11 427 449 22
12 464 483 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 38.55 22.23 54.87
5d_25C Five days - 25 degrees Celsius 26.73 14.35 39.10
7d_25C Seven days - 25 degrees Celsius 24.08 12.74 35.42
10d_25C Ten days - 25 degrees Celsius 23.19 12.22 34.16
7d_15C Seven days - 15 degrees Celsius 32.48 17.96 47.00
7d_30C Seven days - 30 degrees Celsius 16.19 7.81 24.57

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.143642 no
3d_25C 7d_25C 0.050137 no
3d_25C 7d_15C 0.554393 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.037164 yes
5d_25C 7d_25C 0.774710 no
5d_25C 7d_15C 0.516058 no
5d_25C 7d_30C 0.064497 no
5d_25C 10d_25C 0.673941 no
7d_25C 7d_15C 0.278913 no
7d_25C 7d_30C 0.158509 no
7d_25C 10d_25C 0.927343 no
7d_15C 7d_30C 0.007437 yes
7d_15C 10d_25C 0.214422 no
7d_30C 10d_25C 0.222363 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1962.t1
MRSSSVDASADEALARMGYKSELPRNLSMLSILGLSFAIMAAPFGLSTTLYITLSDGLSVTILWGWVFVSLISIA
IAASLAEICAVYPTAGGVYYWSAMLSTRRWAPLMSFIDGWLTLVGNWTVTLSIIFSGGQLILSAISIFNESFVAN
AWQTVLMFWAVMLVCALVNIFFSRYLDLINKVCIFWTAASVIIILVTLLTMADNRRDADFVFAHYDSSTSGWPAG
WAFFVGLLQAAYTLTGYGMVAAMCEEVQNPHREVPKAIVLSVVAAGITGLFYLIPILFVMPNVQMLREVASGQPI
GLLFKTVTGSAGGGFGLLFLILGIMMFAGIGSLTAASRCTYAFARDGAIPGFTLWRQVNTKLDVPVWAIVLSAVV
DGLLGLIYFGSTAAFNSFTGVATICLSTSYGLPILISLIRGRQDVKNSSFSLGRFGFAINCVTIAWIVLAVALFC
MPVTLPVTPESMNYASAVFAGFGAISVIWYFAYARKHFTGPPISGDEARAATELMTGTPVDAEKPLQTMKKLPSE
*
Coding >Pro_DTO377G3_2|g1962.t1
ATGCGAAGTTCTTCTGTCGATGCCTCCGCCGACGAGGCATTGGCCCGTATGGGCTACAAGAGTGAATTGCCTCGA
AACCTGAGCATGCTGAGCATCCTCGGCTTATCCTTTGCCATCATGGCAGCTCCCTTCGGACTGAGCACGACCCTC
TACATCACCCTCTCCGACGGTCTATCCGTCACCATACTCTGGGGTTGGGTCTTCGTCTCCCTGATCTCAATCGCC
ATCGCCGCCTCTCTCGCCGAGATCTGCGCCGTTTACCCAACAGCAGGAGGCGTGTACTACTGGAGCGCGATGCTC
TCAACGCGTCGCTGGGCCCCATTGATGTCCTTCATCGACGGCTGGCTAACCCTCGTGGGCAATTGGACCGTCACA
CTGAGTATCATCTTCTCCGGCGGCCAATTGATCCTCAGCGCCATCTCCATCTTCAATGAGTCCTTCGTTGCCAAT
GCGTGGCAGACCGTATTGATGTTCTGGGCAGTCATGCTCGTCTGCGCCCTAGTCAACATCTTTTTCTCGCGTTAT
CTCGATCTCATCAACAAGGTCTGCATCTTCTGGACCGCAGCCAGTGTCATCATTATCCTTGTCACGCTTTTGACA
ATGGCCGACAACCGCAGAGACGCTGACTTTGTCTTCGCTCACTACGACTCCTCTACGAGCGGCTGGCCCGCTGGA
TGGGCTTTCTTCGTGGGTTTGCTGCAGGCGGCATACACCCTGACCGGCTACGGAATGGTCGCTGCCATGTGCGAA
GAGGTGCAGAACCCACACCGCGAGGTGCCCAAGGCAATCGTGCTATCCGTGGTGGCTGCTGGCATCACCGGCCTG
TTCTACTTGATCCCGATTCTGTTCGTGATGCCCAACGTGCAGATGCTGCGCGAGGTCGCCAGCGGCCAGCCGATC
GGCCTGCTCTTCAAGACAGTGACCGGCTCTGCAGGCGGTGGCTTCGGCTTACTCTTCCTGATTCTGGGGATCATG
ATGTTCGCCGGCATCGGGTCTCTCACAGCTGCCAGTCGCTGCACGTATGCGTTCGCTCGCGACGGCGCCATTCCG
GGCTTCACGCTCTGGCGGCAGGTGAACACCAAGCTGGATGTGCCTGTGTGGGCTATCGTGCTATCGGCCGTCGTG
GATGGATTGCTAGGACTGATCTATTTTGGTTCCACGGCTGCGTTCAACTCCTTCACCGGTGTGGCTACTATCTGT
CTGTCGACCTCGTACGGTCTCCCGATTTTGATCTCTTTGATTCGAGGCCGCCAAGACGTGAAGAATTCCTCGTTC
TCTCTCGGTCGCTTTGGATTCGCCATCAACTGCGTTACCATTGCGTGGATCGTGCTGGCTGTCGCTCTCTTCTGC
ATGCCCGTTACCTTGCCTGTTACCCCGGAGTCTATGAATTATGCCAGTGCTGTTTTCGCTGGATTCGGTGCTATT
AGTGTCATCTGGTACTTTGCCTATGCGCGCAAGCACTTTACTGGACCTCCGATTAGCGGTGACGAGGCGCGCGCC
GCCACCGAGTTGATGACGGGTACGCCAGTGGATGCGGAGAAACCGTTGCAGACGATGAAGAAGTTACCGAGCGAG
TAA
Transcript >Pro_DTO377G3_2|g1962.t1
ATGCGAAGTTCTTCTGTCGATGCCTCCGCCGACGAGGCATTGGCCCGTATGGGCTACAAGAGTGAATTGCCTCGA
AACCTGAGCATGCTGAGCATCCTCGGCTTATCCTTTGCCATCATGGCAGCTCCCTTCGGACTGAGCACGACCCTC
TACATCACCCTCTCCGACGGTCTATCCGTCACCATACTCTGGGGTTGGGTCTTCGTCTCCCTGATCTCAATCGCC
ATCGCCGCCTCTCTCGCCGAGATCTGCGCCGTTTACCCAACAGCAGGAGGCGTGTACTACTGGAGCGCGATGCTC
TCAACGCGTCGCTGGGCCCCATTGATGTCCTTCATCGACGGCTGGCTAACCCTCGTGGGCAATTGGACCGTCACA
CTGAGTATCATCTTCTCCGGCGGCCAATTGATCCTCAGCGCCATCTCCATCTTCAATGAGTCCTTCGTTGCCAAT
GCGTGGCAGACCGTATTGATGTTCTGGGCAGTCATGCTCGTCTGCGCCCTAGTCAACATCTTTTTCTCGCGTTAT
CTCGATCTCATCAACAAGGTCTGCATCTTCTGGACCGCAGCCAGTGTCATCATTATCCTTGTCACGCTTTTGACA
ATGGCCGACAACCGCAGAGACGCTGACTTTGTCTTCGCTCACTACGACTCCTCTACGAGCGGCTGGCCCGCTGGA
TGGGCTTTCTTCGTGGGTTTGCTGCAGGCGGCATACACCCTGACCGGCTACGGAATGGTCGCTGCCATGTGCGAA
GAGGTGCAGAACCCACACCGCGAGGTGCCCAAGGCAATCGTGCTATCCGTGGTGGCTGCTGGCATCACCGGCCTG
TTCTACTTGATCCCGATTCTGTTCGTGATGCCCAACGTGCAGATGCTGCGCGAGGTCGCCAGCGGCCAGCCGATC
GGCCTGCTCTTCAAGACAGTGACCGGCTCTGCAGGCGGTGGCTTCGGCTTACTCTTCCTGATTCTGGGGATCATG
ATGTTCGCCGGCATCGGGTCTCTCACAGCTGCCAGTCGCTGCACGTATGCGTTCGCTCGCGACGGCGCCATTCCG
GGCTTCACGCTCTGGCGGCAGGTGAACACCAAGCTGGATGTGCCTGTGTGGGCTATCGTGCTATCGGCCGTCGTG
GATGGATTGCTAGGACTGATCTATTTTGGTTCCACGGCTGCGTTCAACTCCTTCACCGGTGTGGCTACTATCTGT
CTGTCGACCTCGTACGGTCTCCCGATTTTGATCTCTTTGATTCGAGGCCGCCAAGACGTGAAGAATTCCTCGTTC
TCTCTCGGTCGCTTTGGATTCGCCATCAACTGCGTTACCATTGCGTGGATCGTGCTGGCTGTCGCTCTCTTCTGC
ATGCCCGTTACCTTGCCTGTTACCCCGGAGTCTATGAATTATGCCAGTGCTGTTTTCGCTGGATTCGGTGCTATT
AGTGTCATCTGGTACTTTGCCTATGCGCGCAAGCACTTTACTGGACCTCCGATTAGCGGTGACGAGGCGCGCGCC
GCCACCGAGTTGATGACGGGTACGCCAGTGGATGCGGAGAAACCGTTGCAGACGATGAAGAAGTTACCGAGCGAG
TAA
Gene >Pro_DTO377G3_2|g1962.t1
ATGCGAAGTTCTTCTGTCGATGCCTCCGCCGACGAGGCATTGGCCCGTATGGGCTACAAGAGTGAATTGCCTCGA
AACCTGAGCATGCTGAGCATCCTCGGCTTATCCTTTGCCATCATGGCAGCTCCCTTCGGACTGAGCACGACCCTC
TACATCACCCTCTCCGACGGTCTATCCGTCACCATACTCTGGGGTTGGGTCTTCGTCTCCCTGATCTCAATCGCC
ATCGCCGCCTCTCTCGCCGAGATCTGCGCCGTTTACCCAACAGCAGGAGGCGTGTACTACTGGAGCGCGATGCTC
TCAACGCGTCGCTGGGCCCCATTGATGTCCTTCATCGACGGCTGGCTAACCCTCGTGGGCAATTGGACCGTCACA
CTGAGTATCATCTTCTCCGGCGGCCAATTGATCCTCAGCGCCATCTCCATCTTCAATGAGTCCTTCGTTGCCAAT
GCGTGGCAGACCGTATTGATGTTCTGGGCAGTCATGCTCGTCTGCGCCCTAGTCAACATCTTTTTCTCGCGTTAT
CTCGATCTCATCAACAAGGTCTGCATCTTCTGGACCGCAGCCAGTGTCATCATTATCCTTGTCACGCTTTTGACA
ATGGCCGACAACCGCAGAGACGCTGACTTTGTCTTCGCTCACTACGACTCCTCTACGAGCGGCTGGCCCGCTGGA
TGGGCTTTCTTCGTGGGTTTGCTGCAGGCGGCATACACCCTGACCGGCTACGGAATGGTCGCTGCCATGTGCGAA
GAGGTGCAGAACCCACACCGCGAGGTGCCCAAGGCAATCGTGCTATCCGTGGTGGCTGCTGGCATCACCGGCCTG
TTCTACTTGATCCCGATTCTGTTCGTGATGCCCAACGTGCAGATGCTGCGCGAGGTCGCCAGCGGCCAGCCGATC
GGCCTGCTCTTCAAGACAGTGACCGGCTCTGCAGGCGGTGGCTTCGGCTTACTCTTCCTGATTCTGGGGATCATG
ATGTTCGCCGGCATCGGGTCTCTCACAGCTGCCAGTCGCTGCACGTATGCGTTCGCTCGCGACGGCGCCATTCCG
GGCTTCACGCTCTGGCGGCAGGTGAACACCAAGCTGGATGTGCCTGTGTGGGCTATCGTGCTATCGGCCGTCGTG
GATGGATTGCTAGGACTGATCTATTTTGGTTCCACGGCTGCGTTCAACTCCTTCACCGGTGTGGCTACTATCTGT
CTGTCGACCTCGTACGGTCTCCCGATTTTGATCTCTTTGATTCGAGGCCGCCAAGACGTGAAGAATTCCTCGTTC
TCTCTCGGTCGCTTTGGATTCGCCATCAACTGCGTTACCATTGCGTGGATCGTGCTGGCTGTCGCTCTCTTCTGC
ATGCCCGTTACCTTGCCTGTTACCCCGGAGTCTATGAATTATGCCAGTGCTGTTTTCGCTGGATTCGGTGCTATT
AGTGTCATCTGGTACTTTGCCTATGCGCGCAAGCACTTTACTGGACCTCCGATTAGCGGTGACGAGGCGCGCGCC
GCCACCGAGTTGATGACGGGTACGCCAGTGGATGCGGAGAAACCGTTGCAGACGATGAAGAAGTTACCGAGCGAG
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail