Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1946.t1
Gene name
Locationscaffold_02:1253053..1255165
Strand-
Gene length (bp)2112
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01253 SUI1 Translation initiation factor SUI1 6.9E-22 554 632
PF17832 Pre-PUA Pre-PUA-like domain 3.1E-08 2 126

GO

GO Term Description Terminal node
GO:0006413 translational initiation Yes
GO:0003743 translation initiation factor activity Yes
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0003723 RNA binding No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0003676 nucleic acid binding No
GO:0008135 translation factor activity, RNA binding No
GO:0045182 translation regulator activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1946.t1
MFKKKPTIKNLSPLRSSDRRKIADQIIKDYQIPVTSAPTKADSSGPSTASAPALSLTTIRNALLPDNTQTARFTT
TAGPDLRELQGVVYVGTHPDGDERVLWFKLEHGPGAENRLFPTVYTLWHNPNLVPLLYTPEFVMGKLHGGADLMT
PGLANEPPFPERAVKGAVVAVASVDRHTVPLFVGVCEIDVSALGEVQGTKGHAVRGLHWEGDELWAWSSASLPGR
AAPEYLEGWDEDETEGVEEQMEELKIEDDEPTAASGDIETLSNDPRISEEPVIEVDAPPTEEIDDAFVNAFVYAL
YKHKQDNPSAADHGLPLPITASALIANFTAPYLPVHTPQQAQHYNIKKTSWKNVKKFMKHLDKSKLVKTKERNGQ
ETVIWDVDFEDHRVERFVPYRLPSPRALENNKATAPEGKKSAALDGSDPSVGQTITVQSLYRPSGKLVPTIFPAL
AASDTNNFYKYSEVSSHLDQYLESQNPPIISKENKRIITLNPFLANTIFNSSSTEDKGTLARGKATRDGLLKRLM
DDKTLLSPYHVILKTNQTLADVKPKAGPAPKVHVTLEKRTGSKTVTKVMTLEVFGIIPSLLAQELQKKCAGSTSV
TQATGAPKGIMEVLVQGDQRKAIETALVRRGLKSQMIEVVDKTKKKK*
Coding >Pro_DTO377G3_2|g1946.t1
ATGTTCAAAAAGAAGCCTACGATCAAAAATCTTTCTCCACTACGGTCTTCTGACCGTAGGAAGATTGCCGACCAA
ATTATCAAAGATTACCAAATCCCCGTCACCTCGGCCCCCACCAAAGCAGACTCGTCTGGGCCCAGCACCGCATCT
GCCCCCGCATTGAGCCTCACAACGATCCGGAATGCCCTCCTGCCCGATAACACTCAAACCGCTCGTTTTACAACC
ACTGCTGGTCCAGACCTACGCGAACTTCAAGGGGTCGTATATGTTGGGACACATCCCGACGGCGATGAGCGGGTG
CTATGGTTCAAGCTGGAACACGGCCCGGGGGCCGAAAACCGACTATTCCCAACTGTCTATACACTATGGCACAAC
CCGAACTTGGTTCCGTTACTCTATACTCCGGAGTTTGTGATGGGAAAGCTCCATGGTGGAGCTGATTTAATGACG
CCGGGCCTTGCGAATGAACCTCCGTTCCCTGAAAGGGCGGTCAAGGGCGCCGTTGTTGCGGTCGCGAGTGTAGAC
CGACATACAGTGCCACTTTTTGTGGGCGTCTGTGAGATTGATGTTTCGGCATTGGGAGAGGTGCAAGGCACAAAG
GGCCATGCCGTCCGTGGATTGCATTGGGAGGGTGATGAACTTTGGGCGTGGAGCTCTGCGTCACTGCCGGGCCGT
GCAGCTCCAGAGTACTTGGAGGGCTGGGACGAGGATGAAACCGAGGGTGTTGAAGAACAAATGGAGGAATTGAAA
ATTGAGGATGATGAGCCGACAGCTGCCTCGGGGGACATTGAAACACTAAGCAATGACCCAAGGATATCAGAAGAA
CCCGTCATCGAGGTCGATGCACCCCCAACAGAGGAAATCGACGACGCATTCGTCAATGCTTTTGTCTACGCCCTC
TACAAGCACAAGCAGGATAATCCGTCCGCAGCAGACCATGGCCTTCCACTGCCAATCACAGCTTCGGCATTGATA
GCCAACTTCACTGCTCCTTATCTTCCTGTGCACACACCTCAGCAGGCTCAGCATTACAACATCAAGAAAACCAGT
TGGAAGAACGTAAAGAAGTTCATGAAACATCTAGACAAATCGAAGCTTGTCAAAACCAAGGAACGTAATGGTCAA
GAGACCGTTATTTGGGATGTGGACTTTGAGGACCATCGGGTTGAGCGATTTGTGCCATACAGATTGCCTTCACCG
CGTGCTCTGGAGAACAACAAGGCGACCGCACCCGAGGGCAAAAAGTCGGCTGCGCTGGATGGCTCCGACCCTTCA
GTGGGCCAAACGATCACTGTGCAGAGTCTATATCGGCCATCAGGAAAGCTAGTGCCAACCATTTTCCCTGCCCTC
GCTGCCAGCGACACAAATAACTTCTACAAATACTCCGAAGTTTCCAGTCACTTGGATCAATATCTTGAATCCCAA
AACCCCCCGATCATCTCAAAAGAGAACAAGCGCATCATAACCCTCAACCCATTCCTCGCGAACACCATCTTCAAT
TCATCATCAACCGAAGATAAGGGGACACTGGCACGTGGCAAGGCCACTCGCGATGGTCTTCTTAAACGACTCATG
GATGATAAAACACTGCTTTCGCCGTACCATGTCATTTTGAAGACCAATCAAACTCTTGCAGACGTCAAGCCGAAA
GCAGGCCCCGCACCGAAGGTCCATGTCACCCTCGAGAAGCGGACAGGCTCCAAGACCGTTACCAAAGTTATGACT
TTGGAGGTCTTCGGCATTATTCCTAGTCTGTTGGCACAGGAGCTGCAGAAGAAGTGTGCCGGTAGCACTAGTGTC
ACACAAGCTACTGGTGCCCCCAAGGGGATCATGGAAGTTTTGGTGCAGGGCGACCAGCGAAAGGCCATTGAGACA
GCCCTGGTTCGCCGTGGATTGAAGTCACAGATGATTGAGGTTGTGGATAAGACCAAGAAGAAGAAATGA
Transcript >Pro_DTO377G3_2|g1946.t1
ATGTTCAAAAAGAAGCCTACGATCAAAAATCTTTCTCCACTACGGTCTTCTGACCGTAGGAAGATTGCCGACCAA
ATTATCAAAGATTACCAAATCCCCGTCACCTCGGCCCCCACCAAAGCAGACTCGTCTGGGCCCAGCACCGCATCT
GCCCCCGCATTGAGCCTCACAACGATCCGGAATGCCCTCCTGCCCGATAACACTCAAACCGCTCGTTTTACAACC
ACTGCTGGTCCAGACCTACGCGAACTTCAAGGGGTCGTATATGTTGGGACACATCCCGACGGCGATGAGCGGGTG
CTATGGTTCAAGCTGGAACACGGCCCGGGGGCCGAAAACCGACTATTCCCAACTGTCTATACACTATGGCACAAC
CCGAACTTGGTTCCGTTACTCTATACTCCGGAGTTTGTGATGGGAAAGCTCCATGGTGGAGCTGATTTAATGACG
CCGGGCCTTGCGAATGAACCTCCGTTCCCTGAAAGGGCGGTCAAGGGCGCCGTTGTTGCGGTCGCGAGTGTAGAC
CGACATACAGTGCCACTTTTTGTGGGCGTCTGTGAGATTGATGTTTCGGCATTGGGAGAGGTGCAAGGCACAAAG
GGCCATGCCGTCCGTGGATTGCATTGGGAGGGTGATGAACTTTGGGCGTGGAGCTCTGCGTCACTGCCGGGCCGT
GCAGCTCCAGAGTACTTGGAGGGCTGGGACGAGGATGAAACCGAGGGTGTTGAAGAACAAATGGAGGAATTGAAA
ATTGAGGATGATGAGCCGACAGCTGCCTCGGGGGACATTGAAACACTAAGCAATGACCCAAGGATATCAGAAGAA
CCCGTCATCGAGGTCGATGCACCCCCAACAGAGGAAATCGACGACGCATTCGTCAATGCTTTTGTCTACGCCCTC
TACAAGCACAAGCAGGATAATCCGTCCGCAGCAGACCATGGCCTTCCACTGCCAATCACAGCTTCGGCATTGATA
GCCAACTTCACTGCTCCTTATCTTCCTGTGCACACACCTCAGCAGGCTCAGCATTACAACATCAAGAAAACCAGT
TGGAAGAACGTAAAGAAGTTCATGAAACATCTAGACAAATCGAAGCTTGTCAAAACCAAGGAACGTAATGGTCAA
GAGACCGTTATTTGGGATGTGGACTTTGAGGACCATCGGGTTGAGCGATTTGTGCCATACAGATTGCCTTCACCG
CGTGCTCTGGAGAACAACAAGGCGACCGCACCCGAGGGCAAAAAGTCGGCTGCGCTGGATGGCTCCGACCCTTCA
GTGGGCCAAACGATCACTGTGCAGAGTCTATATCGGCCATCAGGAAAGCTAGTGCCAACCATTTTCCCTGCCCTC
GCTGCCAGCGACACAAATAACTTCTACAAATACTCCGAAGTTTCCAGTCACTTGGATCAATATCTTGAATCCCAA
AACCCCCCGATCATCTCAAAAGAGAACAAGCGCATCATAACCCTCAACCCATTCCTCGCGAACACCATCTTCAAT
TCATCATCAACCGAAGATAAGGGGACACTGGCACGTGGCAAGGCCACTCGCGATGGTCTTCTTAAACGACTCATG
GATGATAAAACACTGCTTTCGCCGTACCATGTCATTTTGAAGACCAATCAAACTCTTGCAGACGTCAAGCCGAAA
GCAGGCCCCGCACCGAAGGTCCATGTCACCCTCGAGAAGCGGACAGGCTCCAAGACCGTTACCAAAGTTATGACT
TTGGAGGTCTTCGGCATTATTCCTAGTCTGTTGGCACAGGAGCTGCAGAAGAAGTGTGCCGGTAGCACTAGTGTC
ACACAAGCTACTGGTGCCCCCAAGGGGATCATGGAAGTTTTGGTGCAGGGCGACCAGCGAAAGGCCATTGAGACA
GCCCTGGTTCGCCGTGGATTGAAGTCACAGATGATTGAGGTTGTGGATAAGACCAAGAAGAAGAAATGA
Gene >Pro_DTO377G3_2|g1946.t1
ATGTTCAAAAAGAAGCCTACGGTAAACGACCTCTCTCCCCGCACTGCCCCTCCAAGCTTTGGGTTTCCAACCCTC
CCACCGCAAAGGACTCTCTGCTCATATAGACCAGATCAAAAATCTTTCTCCACTACGGTCTTCTGACCGTAGGAA
GATTGCCGACCAAATTATCAAAGATTACCAAATCCCCGTCACCTCGGCCCCCACCAAAGCAGACTCGTCTGGGCC
CAGCACCGCATCTGCCCCCGCATTGAGCCTCACAACGATCCGGAATGCCCTCCTGCCCGATAACACTCAAACCGC
TCGTTTTACAACCACTGCTGGTCCAGACCTACGCGAACTTCAAGGGGTCGTATATGTTGGGACACATCCCGACGG
CGATGAGCGGGTGCTATGGTTCAAGCTGGAACACGGCCCGGGGGCCGAAAACCGACTATTCCCAACTGTCTATAC
ACTATGGCACAACCCGAACTTGGTTCCGTTACTCTATACTCCGGAGTTTGTGATGGGAAAGCTCCATGGTGGAGC
TGATTTAATGACGCCGGGCCTTGCGAATGAACCTCCGTTCCCTGAAAGGGCGGTCAAGGGCGCCGTTGTTGCGGT
CGCGAGTGTAGACCGACATACAGTGCCACTTTTTGTGGGCGTCTGTGAGATTGATGTTTCGGCATTGGGAGAGGT
GCAAGGCACAAAGGGCCATGCCGTCCGTGGATTGCATTGGGAGGGTGATGAACTTTGGGCGTGGAGCTCTGCGTC
ACTGCCGGGCCGTGCAGCTCCAGAGTACTTGGAGGGCTGGGACGAGGATGAAACCGAGGGTGTTGAAGAACAAAT
GGAGGAATTGAAAATTGAGGATGATGAGCCGACAGCTGCCTCGGGGGACATTGAAACACTAAGCAATGACCCAAG
GATATCAGAAGAACCCGTCATCGAGGTCGATGCACCCCCAACAGAGGGTGAGTCACCCCTACCTTTCTCTTTATC
AGCCAGCAGTTGGTTTCCCAACTCAAATCAATCAAACACTGACAAATAATAGAAATCGACGACGCATTCGTCAAT
GCTTTTGTCTACGCCCTCTACAAGCACAAGCAGGATAATCCGTCCGCAGCAGACCATGGCCTTCCACTGCCAATC
ACAGCTTCGGCATTGATAGCCAACTTCACTGCTCCTTATCTTCCTGTGCACACACCTCAGCAGGCTCAGCATTAC
AACATCAAGAAAACCAGTTGGAAGAACGTAAAGAAGTTCATGAAACATCTAGACAAATCGAAGCTTGTCAAAACC
AAGGAACGTAATGGTCAAGAGACCGTTATTTGGGATGTGGACTTTGAGGACCATCGGGTTGAGCGATTTGTGCCA
TACAGATTGCCTTCACCGCGTGCTCTGGAGAACAACAAGGCGACCGCACCCGAGGGCAAAAAGTCGGCTGCGCTG
GATGGCTCCGACCCTTCAGTGGGCCAAACGATCACTGTGCAGAGTCTATATCGGCCATCAGGAAAGCTAGTGCCA
ACCATTTTCCCTGCCCTCGCTGCCAGCGACACAAATAACTTCTACAAATACTCCGAAGTTTCCAGTCACTTGGAT
CAATATCTTGAATCCCAAAACCCCCCGATCATCTCAAAAGAGAACAAGCGCATCATAACCCTCAACCCATTCCTC
GCGAACACCATCTTCAATTCATCATCAACCGAAGATAAGGGGACACTGGCACGTGGCAAGGCCACTCGCGATGGT
CTTCTTAAACGACTCATGGATGATAAAACACTGCTTTCGCCGTACCATGTCATTTTGAAGACCAATCAAACTCTT
GCAGACGTCAAGCCGAAAGCAGGCCCCGCACCGAAGGTCCATGTCACCCTCGAGAAGCGGACAGGCTCCAAGACC
GTTACCAAAGTTATGACTTTGGAGGTCTTCGGCATTATTCCTAGTCTGTTGGCACAGGAGCTGCAGAAGAAGTGT
GCCGGTAGCACTAGTGTCACACAAGCTACTGGTGCCCCCAAGGGGATCATGGAAGTTTTGGTGCAGGGCGACCAG
CGAAAGGCCATTGAGACAGCCCTGGTTCGCCGTGGATTGAAGTCACAGATGATTGAGGTTGTGGATAAGACCAAG
AAGAAGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail