Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1932.t1
Gene name
Locationscaffold_02:1204615..1207070
Strand-
Gene length (bp)2455
Transcript length (bp)2298
Coding sequence length (bp)2298
Protein length (aa) 766

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03190 Thioredox_DsbH Protein of unknown function, DUF255 2.2E-71 3 169
PF13899 Thioredoxin_7 Thioredoxin-like 1.6E-06 23 112

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 154.10 91.64 216.57
5d_25C Five days - 25 degrees Celsius 245.20 139.58 350.83
7d_25C Seven days - 25 degrees Celsius 261.63 147.16 376.11
10d_25C Ten days - 25 degrees Celsius 330.64 183.33 477.94
7d_15C Seven days - 15 degrees Celsius 287.54 154.66 420.42
7d_30C Seven days - 30 degrees Celsius 201.07 113.75 288.38

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.036724 yes
3d_25C 7d_25C 0.017762 yes
3d_25C 7d_15C 0.003625 yes
3d_25C 7d_30C 0.289824 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.856428 no
5d_25C 7d_15C 0.602222 no
5d_25C 7d_30C 0.481809 no
5d_25C 10d_25C 0.246169 no
7d_25C 7d_15C 0.787911 no
7d_25C 7d_30C 0.319353 no
7d_25C 10d_25C 0.396635 no
7d_15C 7d_30C 0.161166 no
7d_15C 10d_25C 0.667299 no
7d_30C 10d_25C 0.028642 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1932.t1
MVNRLQQSKSPYVRGHMNNPVAWQVWDAKAMELAKKHNRLIFLSIGYSACHWCHVMERESFMSPEVASILNESFV
PIKVDREERPDIDDVYMNYVQATTGSGGWPLNVFLTPNLEPVFGGTYWQGPNSNTFTGPEAIGFVEILEKLRDVW
QTQQQRCLDSAKEITKQLKEFAEEGTHGDRDNDNDEEMDIELLEEAYQHFASRYDSVNGGFGRAPKFPTPSNLSF
LIRLGAYPTQVTDVVGHDECEQATAMAVTTLVNMARGGIRDHIGHGFARYSVTMDWGLPHFEKMLYDQAQLLDVY
VDAFRLTHDPELLGAVYDLSAYLTSAPIQSPTGGFFSSEDADSYPHPNDTEKREGAFYVWSLKELTSVLGPRDAP
VCAKHWGVLPDGNVPPEYDPHDEFMNQNVLSVRATPSKLARDFGLSEEEVVKIIKSSKLKLHDYRERTRGRPDLD
DKIIVAWNGLAIGALAKCSVLFEEIESSKAVHCREAAARAISFIKDKLFDKGTGQLWRIYRDGSRGDTPGFADDY
AYLASGLLDMYEATYDDSYLQFAERLQRYLNEYFLDESGSTATGYFSTPSVVTPGMPAPILRLKTGTESATPSIN
GVIARNLLRLSALLADESYRTLARQTCNTFAVEIIQHPFLFVGMLDVIVGLQIGTRTVTGVFSTPDVSSVPKPRG
DNFLSRNDEPVSALDLIQRRVRAEAGVAVSSSVVVTSLVDIRPSHLKDFVGNLSFWLKSRNALFQDLKAGEPAKN
YMMICETGKCQTKNL*
Coding >Pro_DTO377G3_2|g1932.t1
ATGGTCAATCGTCTGCAGCAAAGCAAATCCCCCTATGTCCGAGGACATATGAACAACCCGGTAGCATGGCAAGTC
TGGGATGCAAAAGCTATGGAGCTTGCCAAGAAGCACAATCGTTTAATCTTTCTCAGTATCGGTTACTCCGCATGT
CATTGGTGCCATGTCATGGAAAGAGAATCGTTTATGTCACCAGAGGTGGCCTCGATTCTGAACGAATCCTTCGTC
CCGATCAAGGTTGATCGCGAAGAGCGACCAGACATCGACGACGTTTACATGAATTATGTCCAGGCCACGACGGGT
TCTGGTGGCTGGCCCTTGAATGTGTTTTTGACTCCTAACCTTGAGCCCGTGTTTGGTGGCACTTACTGGCAAGGC
CCAAATTCAAACACATTCACGGGCCCCGAGGCAATCGGGTTTGTGGAGATTTTAGAAAAATTGAGAGATGTGTGG
CAGACACAACAGCAGCGTTGTCTCGACAGCGCCAAAGAAATCACCAAGCAGTTGAAAGAGTTTGCCGAGGAAGGG
ACACATGGTGACCGCGATAATGATAATGACGAGGAAATGGATATTGAGCTTCTAGAAGAAGCGTATCAGCATTTC
GCCTCTCGATACGACTCGGTCAATGGCGGCTTTGGCCGCGCACCGAAATTTCCTACACCCTCTAACCTCAGCTTC
CTAATCCGGCTCGGTGCCTATCCGACCCAGGTCACGGATGTTGTAGGGCATGATGAGTGTGAACAAGCAACCGCG
ATGGCTGTCACGACGCTAGTGAACATGGCTCGTGGCGGCATTAGGGACCATATCGGCCATGGATTCGCACGGTAC
AGCGTGACGATGGACTGGGGTCTCCCTCATTTCGAGAAGATGCTGTATGACCAGGCACAGCTGTTGGATGTCTAC
GTGGATGCTTTCCGGCTTACTCACGACCCCGAACTTTTAGGCGCTGTCTATGATTTGTCCGCCTACTTGACGAGC
GCCCCGATACAGTCGCCCACCGGAGGGTTCTTTTCCTCGGAAGATGCCGACAGTTACCCCCATCCAAATGACACC
GAAAAGCGAGAGGGTGCCTTTTATGTCTGGTCGCTGAAGGAACTCACCTCAGTCCTCGGCCCTCGGGATGCTCCA
GTCTGCGCCAAACACTGGGGTGTTCTCCCTGACGGCAACGTGCCCCCCGAGTATGACCCTCACGATGAGTTCATG
AACCAGAACGTGTTGTCCGTCCGTGCCACGCCGAGCAAACTCGCTAGAGACTTCGGTCTTAGCGAGGAAGAAGTA
GTGAAGATCATCAAGTCGTCAAAGCTGAAGTTGCACGATTATCGCGAACGAACACGCGGGCGGCCAGACCTGGAT
GACAAGATTATTGTGGCCTGGAATGGATTGGCGATCGGTGCGCTTGCCAAGTGTAGTGTTCTGTTTGAGGAGATC
GAGAGCTCCAAGGCCGTGCATTGTCGCGAAGCGGCAGCACGGGCAATCAGTTTCATCAAGGACAAGCTCTTCGAT
AAAGGCACGGGACAGCTATGGCGCATTTACCGCGATGGAAGTCGTGGAGACACCCCGGGTTTTGCCGACGACTAC
GCATACTTGGCTAGCGGATTGCTTGATATGTATGAGGCTACTTACGACGACAGCTATCTTCAATTTGCGGAGCGA
TTGCAAAGATACCTCAATGAATACTTCTTGGATGAGAGTGGCTCTACAGCTACCGGATACTTCAGTACACCTTCC
GTCGTCACCCCTGGCATGCCTGCCCCGATCCTCCGTCTCAAAACTGGCACCGAGTCAGCAACACCTTCGATCAAC
GGAGTCATTGCGCGTAATCTACTGCGCCTGTCCGCTCTTCTCGCGGATGAGAGTTACCGGACCCTGGCTCGGCAG
ACGTGCAACACCTTCGCGGTGGAGATCATCCAGCACCCCTTCCTGTTTGTAGGCATGCTGGACGTGATTGTGGGC
CTCCAGATTGGCACTCGCACAGTGACGGGTGTGTTCTCCACGCCCGATGTCTCTTCGGTCCCTAAGCCACGTGGC
GACAATTTCCTCAGTCGGAACGATGAGCCCGTGTCAGCACTCGACCTGATCCAGCGACGTGTCCGGGCCGAGGCC
GGCGTGGCCGTGTCCTCGTCTGTCGTGGTCACTTCGCTTGTCGACATTCGCCCCTCACATCTGAAAGACTTTGTG
GGAAACCTGTCCTTCTGGCTCAAATCCCGAAATGCTCTCTTCCAAGATTTGAAGGCCGGCGAGCCAGCCAAGAAC
TACATGATGATTTGTGAGACTGGGAAATGCCAAACTAAAAATCTCTAG
Transcript >Pro_DTO377G3_2|g1932.t1
ATGGTCAATCGTCTGCAGCAAAGCAAATCCCCCTATGTCCGAGGACATATGAACAACCCGGTAGCATGGCAAGTC
TGGGATGCAAAAGCTATGGAGCTTGCCAAGAAGCACAATCGTTTAATCTTTCTCAGTATCGGTTACTCCGCATGT
CATTGGTGCCATGTCATGGAAAGAGAATCGTTTATGTCACCAGAGGTGGCCTCGATTCTGAACGAATCCTTCGTC
CCGATCAAGGTTGATCGCGAAGAGCGACCAGACATCGACGACGTTTACATGAATTATGTCCAGGCCACGACGGGT
TCTGGTGGCTGGCCCTTGAATGTGTTTTTGACTCCTAACCTTGAGCCCGTGTTTGGTGGCACTTACTGGCAAGGC
CCAAATTCAAACACATTCACGGGCCCCGAGGCAATCGGGTTTGTGGAGATTTTAGAAAAATTGAGAGATGTGTGG
CAGACACAACAGCAGCGTTGTCTCGACAGCGCCAAAGAAATCACCAAGCAGTTGAAAGAGTTTGCCGAGGAAGGG
ACACATGGTGACCGCGATAATGATAATGACGAGGAAATGGATATTGAGCTTCTAGAAGAAGCGTATCAGCATTTC
GCCTCTCGATACGACTCGGTCAATGGCGGCTTTGGCCGCGCACCGAAATTTCCTACACCCTCTAACCTCAGCTTC
CTAATCCGGCTCGGTGCCTATCCGACCCAGGTCACGGATGTTGTAGGGCATGATGAGTGTGAACAAGCAACCGCG
ATGGCTGTCACGACGCTAGTGAACATGGCTCGTGGCGGCATTAGGGACCATATCGGCCATGGATTCGCACGGTAC
AGCGTGACGATGGACTGGGGTCTCCCTCATTTCGAGAAGATGCTGTATGACCAGGCACAGCTGTTGGATGTCTAC
GTGGATGCTTTCCGGCTTACTCACGACCCCGAACTTTTAGGCGCTGTCTATGATTTGTCCGCCTACTTGACGAGC
GCCCCGATACAGTCGCCCACCGGAGGGTTCTTTTCCTCGGAAGATGCCGACAGTTACCCCCATCCAAATGACACC
GAAAAGCGAGAGGGTGCCTTTTATGTCTGGTCGCTGAAGGAACTCACCTCAGTCCTCGGCCCTCGGGATGCTCCA
GTCTGCGCCAAACACTGGGGTGTTCTCCCTGACGGCAACGTGCCCCCCGAGTATGACCCTCACGATGAGTTCATG
AACCAGAACGTGTTGTCCGTCCGTGCCACGCCGAGCAAACTCGCTAGAGACTTCGGTCTTAGCGAGGAAGAAGTA
GTGAAGATCATCAAGTCGTCAAAGCTGAAGTTGCACGATTATCGCGAACGAACACGCGGGCGGCCAGACCTGGAT
GACAAGATTATTGTGGCCTGGAATGGATTGGCGATCGGTGCGCTTGCCAAGTGTAGTGTTCTGTTTGAGGAGATC
GAGAGCTCCAAGGCCGTGCATTGTCGCGAAGCGGCAGCACGGGCAATCAGTTTCATCAAGGACAAGCTCTTCGAT
AAAGGCACGGGACAGCTATGGCGCATTTACCGCGATGGAAGTCGTGGAGACACCCCGGGTTTTGCCGACGACTAC
GCATACTTGGCTAGCGGATTGCTTGATATGTATGAGGCTACTTACGACGACAGCTATCTTCAATTTGCGGAGCGA
TTGCAAAGATACCTCAATGAATACTTCTTGGATGAGAGTGGCTCTACAGCTACCGGATACTTCAGTACACCTTCC
GTCGTCACCCCTGGCATGCCTGCCCCGATCCTCCGTCTCAAAACTGGCACCGAGTCAGCAACACCTTCGATCAAC
GGAGTCATTGCGCGTAATCTACTGCGCCTGTCCGCTCTTCTCGCGGATGAGAGTTACCGGACCCTGGCTCGGCAG
ACGTGCAACACCTTCGCGGTGGAGATCATCCAGCACCCCTTCCTGTTTGTAGGCATGCTGGACGTGATTGTGGGC
CTCCAGATTGGCACTCGCACAGTGACGGGTGTGTTCTCCACGCCCGATGTCTCTTCGGTCCCTAAGCCACGTGGC
GACAATTTCCTCAGTCGGAACGATGAGCCCGTGTCAGCACTCGACCTGATCCAGCGACGTGTCCGGGCCGAGGCC
GGCGTGGCCGTGTCCTCGTCTGTCGTGGTCACTTCGCTTGTCGACATTCGCCCCTCACATCTGAAAGACTTTGTG
GGAAACCTGTCCTTCTGGCTCAAATCCCGAAATGCTCTCTTCCAAGATTTGAAGGCCGGCGAGCCAGCCAAGAAC
TACATGATGATTTGTGAGACTGGGAAATGCCAAACTAAAAATCTCTAG
Gene >Pro_DTO377G3_2|g1932.t1
ATGGTCAATCGTCTGCAGCAAAGCAAATCCCCCTATGTGAGAGATGTGTTCCTATGAGATAAATGGCAACACGCT
CATGGAATAACAGGTCCGAGGACATATGAACAACCCGGTAGCATGGCAAGTCTGGGATGCAAAAGCTATGGAGCT
TGCCAAGAAGCACAATCGTTTAATCTTTCTCAGTATCGGTTACTCCGCATGTCATTGTAGGTTACAACTATTTCA
CTGGGCGTACCGGCATTCTAATATTGCCTAGGGTGCCATGTCATGGAAAGAGAATCGTTTATGTCACCAGAGGTG
GCCTCGATTCTGAACGAATCCTTCGTCCCGATCAAGGTTGATCGCGAAGAGCGACCAGACATCGACGACGTTTAC
ATGAATTATGTCCAGGCCACGACGGGTTCTGGTGGCTGGCCCTTGAATGTGTTTTTGACTCCTAACCTTGAGCCC
GTGTTTGGTGGCACTTACTGGCAAGGCCCAAATTCAAACACATTCACGGGCCCCGAGGCAATCGGGTTTGTGGAG
ATTTTAGAAAAATTGAGAGATGTGTGGCAGACACAACAGCAGCGTTGTCTCGACAGCGCCAAAGAAATCACCAAG
CAGTTGAAAGAGTTTGCCGAGGAAGGGACACATGGTGACCGCGATAATGATAATGACGAGGAAATGGATATTGAG
CTTCTAGAAGAAGCGTATCAGCATTTCGCCTCTCGATACGACTCGGTCAATGGCGGCTTTGGCCGCGCACCGAAA
TTTCCTACACCCTCTAACCTCAGCTTCCTAATCCGGCTCGGTGCCTATCCGACCCAGGTCACGGATGTTGTAGGG
CATGATGAGTGTGAACAAGCAACCGCGATGGCTGTCACGACGCTAGTGAACATGGCTCGTGGCGGCATTAGGGAC
CATATCGGCCATGGATTCGCACGGTACAGCGTGACGATGGACTGGGGTCTCCCTCATTTCGAGAAGATGCTGTAT
GACCAGGCACAGCTGTTGGATGTCTACGTGGATGCTTTCCGGCTTACTCACGACCCCGAACTTTTAGGCGCTGTC
TATGATTTGTCCGCCTACTTGACGAGCGCCCCGATACAGTCGCCCACCGGAGGGTTCTTTTCCTCGGAAGATGCC
GACAGTTACCCCCATCCAAATGACACCGAAAAGCGAGAGGGTGCCTTTTATGTCTGGTCGCTGAAGGAACTCACC
TCAGTCCTCGGCCCTCGGGATGCTCCAGTCTGCGCCAAACACTGGGGTGTTCTCCCTGACGGCAACGTGCCCCCC
GAGTATGACCCTCACGATGAGTTCATGAACCAGAACGTGTTGTCCGTCCGTGCCACGCCGAGCAAACTCGCTAGA
GACTTCGGTCTTAGCGAGGAAGAAGTAGTGAAGATCATCAAGTCGTCAAAGCTGAAGTTGCACGATTATCGCGAA
CGAACACGCGGGCGGCCAGACCTGGATGACAAGATTATTGTGGCCTGGAATGGATTGGCGATCGGTGCGCTTGCC
AAGTGTAGTGTTCTGTTTGAGGAGATCGAGAGCTCCAAGGCCGTGCATTGTCGCGAAGCGGCAGCACGGGCAATC
AGTTTCATCAAGGACAAGCTCTTCGATAAAGGCACGGGACAGCTATGGCGCATTTACCGCGATGGAAGTCGTGGA
GACACCCCGGGTTTTGCCGACGACTACGCATACTTGGCTAGCGGATTGCTTGATATGTATGAGGCTACTTACGAC
GACAGCTATCTTCAATTTGCGGAGCGATTGCAAAGTGAGAATAGCCCCATTTCTATGAACGGGACCTTGTGGCTA
ACTTGTGATTCTAGGATACCTCAATGAATACTTCTTGGATGAGAGTGGCTCTACAGCTACCGGATACTTCAGTAC
ACCTTCCGTCGTCACCCCTGGCATGCCTGCCCCGATCCTCCGTCTCAAAACTGGCACCGAGTCAGCAACACCTTC
GATCAACGGAGTCATTGCGCGTAATCTACTGCGCCTGTCCGCTCTTCTCGCGGATGAGAGTTACCGGACCCTGGC
TCGGCAGACGTGCAACACCTTCGCGGTGGAGATCATCCAGCACCCCTTCCTGTTTGTAGGCATGCTGGACGTGAT
TGTGGGCCTCCAGATTGGCACTCGCACAGTGACGGGTGTGTTCTCCACGCCCGATGTCTCTTCGGTCCCTAAGCC
ACGTGGCGACAATTTCCTCAGTCGGAACGATGAGCCCGTGTCAGCACTCGACCTGATCCAGCGACGTGTCCGGGC
CGAGGCCGGCGTGGCCGTGTCCTCGTCTGTCGTGGTCACTTCGCTTGTCGACATTCGCCCCTCACATCTGAAAGA
CTTTGTGGGAAACCTGTCCTTCTGGCTCAAATCCCGAAATGCTCTCTTCCAAGATTTGAAGGCCGGCGAGCCAGC
CAAGAACTACATGATGATTTGTGAGACTGGGAAATGCCAAACTAAAAATCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail