Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1931.t1
Gene name
Locationscaffold_02:1202024..1203061
Strand-
Gene length (bp)1037
Transcript length (bp)987
Coding sequence length (bp)987
Protein length (aa) 329

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00188 CAP Cysteine-rich secretory protein family 2.8E-17 177 309

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 143.23 84.84 201.62
5d_25C Five days - 25 degrees Celsius 104.73 60.22 149.23
7d_25C Seven days - 25 degrees Celsius 85.63 49.00 122.26
10d_25C Ten days - 25 degrees Celsius 76.02 41.75 110.28
7d_15C Seven days - 15 degrees Celsius 107.72 49.61 165.82
7d_30C Seven days - 30 degrees Celsius 104.80 58.40 151.19

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.182833 no
3d_25C 7d_25C 0.016098 yes
3d_25C 7d_15C 0.316786 no
3d_25C 7d_30C 0.197494 no
3d_25C 10d_25C 0.002761 yes
5d_25C 7d_25C 0.457004 no
5d_25C 7d_15C 0.944827 no
5d_25C 7d_30C 0.998176 no
5d_25C 10d_25C 0.196290 no
7d_25C 7d_15C 0.448082 no
7d_25C 7d_30C 0.456762 no
7d_25C 10d_25C 0.703699 no
7d_15C 7d_30C 0.947827 no
7d_15C 10d_25C 0.220194 no
7d_30C 10d_25C 0.199147 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1931.t1
MRSAVIVAALAVGTCARVIEKEVYVTQWTTTTVTETITQWPTSTSTLNTAVLVKQSTKTANAAHPTVDVSRKEVE
SAPAAASTTTAAGVEAVEPSSATSSTSSSTTSSIVPSSTTEAEIVAVTSSATSVATSSEAPATVAPTTTAAATTS
VATSSATSTTAAAATSSSTDSYQESILYYHNIHRSAHSVGDLTWSDDLAGAANTLASRCVYGHDTSIVSASGDYG
QNIAYGYDAAEVGEKIISGMMYTDEAPYFANLYGEANPDMTNFEKWGHFTQIVWKATTQVGCATVSCSDLGNVGS
AAPYTVCNYGSPGNYAGEYADNVLKPTS*
Coding >Pro_DTO377G3_2|g1931.t1
ATGCGTTCTGCTGTCATCGTTGCCGCCTTGGCGGTCGGCACTTGTGCCAGAGTTATTGAGAAGGAGGTTTACGTG
ACCCAGTGGACTACCACCACCGTCACCGAAACCATCACCCAGTGGCCCACCAGCACCAGCACCCTCAACACTGCT
GTTTTGGTCAAGCAGTCCACCAAGACCGCCAACGCCGCCCACCCCACTGTCGATGTTTCCAGGAAGGAGGTCGAG
TCTGCCCCTGCTGCGGCTTCGACTACTACTGCCGCCGGGGTTGAGGCTGTGGAACCCAGTAGCGCGACCAGCTCA
ACCTCGTCTTCGACCACCTCTTCGATCGTCCCATCTTCGACTACTGAGGCTGAAATCGTGGCCGTGACCTCCTCG
GCTACCTCCGTCGCTACCTCTTCGGAAGCCCCGGCCACCGTCGCCCCGACCACCACCGCCGCTGCTACCACCTCC
GTCGCGACCTCTTCGGCAACCTCGACCACCGCCGCTGCTGCCACCTCCAGCTCTACCGACTCCTACCAGGAGTCC
ATTCTGTACTACCACAACATCCACCGTAGCGCGCACTCTGTAGGCGATCTGACCTGGTCCGATGACCTCGCCGGA
GCTGCCAACACCCTCGCCTCTCGTTGCGTGTACGGACACGACACTTCCATCGTGTCCGCCAGCGGAGACTACGGC
CAGAACATCGCCTACGGTTACGACGCGGCAGAGGTCGGTGAGAAGATTATCAGCGGAATGATGTACACCGATGAG
GCGCCATACTTCGCCAACCTCTACGGTGAGGCCAACCCTGATATGACCAACTTCGAGAAGTGGGGCCACTTCACT
CAGATCGTCTGGAAAGCTACCACTCAAGTTGGTTGCGCCACCGTCAGCTGCTCTGACTTGGGCAATGTTGGCAGC
GCCGCGCCTTACACTGTCTGCAACTATGGCTCCCCTGGTAACTACGCCGGCGAGTATGCCGACAACGTCTTGAAG
CCCACTTCATAA
Transcript >Pro_DTO377G3_2|g1931.t1
ATGCGTTCTGCTGTCATCGTTGCCGCCTTGGCGGTCGGCACTTGTGCCAGAGTTATTGAGAAGGAGGTTTACGTG
ACCCAGTGGACTACCACCACCGTCACCGAAACCATCACCCAGTGGCCCACCAGCACCAGCACCCTCAACACTGCT
GTTTTGGTCAAGCAGTCCACCAAGACCGCCAACGCCGCCCACCCCACTGTCGATGTTTCCAGGAAGGAGGTCGAG
TCTGCCCCTGCTGCGGCTTCGACTACTACTGCCGCCGGGGTTGAGGCTGTGGAACCCAGTAGCGCGACCAGCTCA
ACCTCGTCTTCGACCACCTCTTCGATCGTCCCATCTTCGACTACTGAGGCTGAAATCGTGGCCGTGACCTCCTCG
GCTACCTCCGTCGCTACCTCTTCGGAAGCCCCGGCCACCGTCGCCCCGACCACCACCGCCGCTGCTACCACCTCC
GTCGCGACCTCTTCGGCAACCTCGACCACCGCCGCTGCTGCCACCTCCAGCTCTACCGACTCCTACCAGGAGTCC
ATTCTGTACTACCACAACATCCACCGTAGCGCGCACTCTGTAGGCGATCTGACCTGGTCCGATGACCTCGCCGGA
GCTGCCAACACCCTCGCCTCTCGTTGCGTGTACGGACACGACACTTCCATCGTGTCCGCCAGCGGAGACTACGGC
CAGAACATCGCCTACGGTTACGACGCGGCAGAGGTCGGTGAGAAGATTATCAGCGGAATGATGTACACCGATGAG
GCGCCATACTTCGCCAACCTCTACGGTGAGGCCAACCCTGATATGACCAACTTCGAGAAGTGGGGCCACTTCACT
CAGATCGTCTGGAAAGCTACCACTCAAGTTGGTTGCGCCACCGTCAGCTGCTCTGACTTGGGCAATGTTGGCAGC
GCCGCGCCTTACACTGTCTGCAACTATGGCTCCCCTGGTAACTACGCCGGCGAGTATGCCGACAACGTCTTGAAG
CCCACTTCATAA
Gene >Pro_DTO377G3_2|g1931.t1
ATGCGTTCTGCTGTCATCGTTGCCGCCTTGGCGGTCGGCACTTGTGCCAGAGTTATTGAGAAGGAGGTTTACGTG
ACCCAGTGGACTACCACCACCGTCACCGAAACCATCACCCAGTGGCCCACCAGCACCAGCACCCTCAACACTGCT
GTTTTGGTCAAGCAGTCCACCAAGACCGCCAACGCCGCCCACCCCACTGTCGATGTTTCCAGGAAGGAGGTCGAG
TCTGCCCCTGCTGCGGCTTCGACTACTACTGCCGCCGGGGTTGAGGCTGTGGAACCCAGTAGCGCGACCAGCTCA
ACCTCGTCTTCGACCACCTCTTCGATCGTCCCATCTTCGACTACTGAGGCTGAAATCGTGGCCGTGACCTCCTCG
GCTACCTCCGTCGCTACCTCTTCGGAAGCCCCGGCCACCGTCGCCCCGACCACCACCGCCGCTGCTACCACCTCC
GTCGCGACCTCTTCGGCAACCTCGACCACCGCCGCTGCTGCCACCTCCAGCTCTACCGACTCCTACCAGGAGTCC
ATTCTGTACTACCACAACATCCACCGTAGCGCGCACTCTGTAGGCGATCTGACCTGGTCCGATGACCTCGCCGGA
GCTGCCAACACCCTCGCCTCTCGTTGCGTGTACGGACACGACACGTAAGTATTCCTCTGTTTTGCTTGAGAAACA
ATAATCCTAACGTGACTAGTTCCATCGTGTCCGCCAGCGGAGACTACGGCCAGAACATCGCCTACGGTTACGACG
CGGCAGAGGTCGGTGAGAAGATTATCAGCGGAATGATGTACACCGATGAGGCGCCATACTTCGCCAACCTCTACG
GTGAGGCCAACCCTGATATGACCAACTTCGAGAAGTGGGGCCACTTCACTCAGATCGTCTGGAAAGCTACCACTC
AAGTTGGTTGCGCCACCGTCAGCTGCTCTGACTTGGGCAATGTTGGCAGCGCCGCGCCTTACACTGTCTGCAACT
ATGGCTCCCCTGGTAACTACGCCGGCGAGTATGCCGACAACGTCTTGAAGCCCACTTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail