Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1921.t1
Gene name
Locationscaffold_02:1179539..1183853
Strand-
Gene length (bp)4314
Transcript length (bp)4314
Coding sequence length (bp)4314
Protein length (aa) 1438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 4.7E-45 1031 1203
PF00122 E1-E2_ATPase E1-E2 ATPase 2.6E-38 389 597
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.4E-20 678 767
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 2.8E-18 615 958
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 5.9E-08 288 331
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 1.9E-04 930 991

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 313 335 22
2 350 372 22
3 523 545 22
4 560 591 31
5 1004 1026 22
6 1031 1053 22
7 1074 1096 22
8 1111 1130 19
9 1150 1172 22
10 1182 1204 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1921.t1
MSDPRSKDEPGQSSTLRRERAPTITIDTSAVNPPDNEYTPLQIRSGGSRMYTDNAHAPDTTALLSNGSRNGSASS
TDMHSTASIRSNASSEARDRESRPTSPHNISSPKTKAAETHSNFLSVPGTRSRGNSLESEETNQTSSTYGGDTYV
PSSSQESASDSPKSPATNGVHDEDPLSPDPGREDEFEVEDNKFAFSPGQLNKLLNPKSFGAFHALGGLRGLEKGL
RTDIKSGLSVDETNLDGTVSFDEVVTPTTPASGTNMPKSASPTKPPPPTTEGSVITQHNGENFVDRRRIYGDNRL
PERKLKTIWELAWIAYNDKVLILLTIAAIVSLAVGIPQSLHPANPDEPGVEWVEGLAILVAIIIVVVVGAANDWQ
KEQQFAKLNKKKENRQVKVKRSGRTEEISVHDVLVGDVMFLEPGDMVPVDGILIDGYDLKCDESSATGESDVLRK
TPGDEVYKTMEQNEDLKKMDPFIISGAKVSEGVGTFVVTATGTHATLGRTMMSLQEEGETTPLQTKLNKLAEYIA
KLGLASGLLLFVVLFIKFLVRLKDIAGGPDAKGQAFLQIFIVAVTIVVVAVPEGLPLAVTLALAFATTRMLKDNN
LVRYLKACETMGNATTICSDKTGTLTENKMTAVAATLGTTSRFGKYSGVSSDDQSEITPSDFVSSLSPSVKDVLL
KSIVYNSTAFEGETDGVKTYVGSKTETALLTFARDYLGLGPLGEARANGKVVQMFPFDSGRKCMAVVTQLENGKY
RMLVKGAAEILSHKSTRIVQDPTDTLSETPVTDENRTALDSIMTTYATRSLRCIALVYRDFDQWPPRGAPTSETD
DTQAVFEPIFKDMAMLGIFGIQDPVRAGVAEAVYTCQRAGVFVRMVTGDNIMTAKAIAQECGIYTPGGIAIEGPK
FRKLSTRQMNQIIPRLQVIARSSPEDKKILVNQLKKLGETVAVTGDGTNDAPALKNADVGFAMGITGTEVAKEAS
DIILMDDNFSSIVKAMAWGRTVCDAVKKFLQFQITVNITAVILTFVSAVASDNEDSVLSAVQLLWVNLIMDTFAA
LALATDPPTETVLDRRPESKSDPLITLTMWKMIIGQSIYQLVVTFVLNFAGDKIFSWDSGHLQTVVFNTFVFMQI
FNQYNSRRIDNKLNILEGILRNRWFIGIQIIIIGGQILIIFFGGAAFSVKRLNEGSQWAVSLVLGAISIPIAVII
RLIPDEFISRLIPHFWNRNKGPALVISDEDRNYEWNPALEEIRDQLAFLKRVRGGRLRHLRHKLQHPQEFLPRSR
SGSRSRDSSTPPTPNGDNDHENDNGSPQPTTPESRSRRNTRSRSNSTFGPAAAMAGIVAGSIAGWSPIERGHDEP
EQVTFPTNGGPHSGLDREPGIEIHPDTAADDRILNEYSPDSKTPPSQNPDLIPFFEHAPPDRAPSSRGRRSLSQR
SRSRSSLSQSHV*
Coding >Pro_DTO377G3_2|g1921.t1
ATGTCCGACCCACGCTCAAAAGATGAGCCCGGCCAATCGTCAACCCTGCGCAGGGAGCGCGCGCCGACTATTACT
ATCGACACCTCGGCCGTGAACCCCCCGGATAACGAATACACGCCTTTACAAATCCGCTCGGGAGGATCACGGATG
TACACTGATAACGCACATGCCCCCGATACAACCGCACTGCTAAGCAATGGCAGTCGCAATGGCAGTGCCTCTTCT
ACGGATATGCATTCCACAGCATCAATTCGCTCCAATGCATCCTCCGAAGCTCGGGACCGAGAGAGCCGGCCAACC
TCACCTCACAACATCTCATCGCCCAAGACGAAGGCGGCCGAGACACATTCCAACTTCCTTTCCGTCCCTGGAACA
CGCTCGAGAGGCAACTCGTTGGAGTCGGAGGAGACCAACCAAACATCGAGCACCTACGGCGGCGACACATATGTG
CCCTCATCATCTCAGGAATCCGCATCCGATTCGCCTAAAAGTCCCGCCACAAACGGCGTTCACGATGAGGATCCC
CTGTCCCCAGACCCCGGCCGCGAAGACGAGTTTGAGGTCGAGGATAACAAGTTTGCCTTTTCCCCTGGTCAGCTG
AACAAGCTTCTCAATCCGAAGAGCTTTGGCGCCTTCCATGCGTTGGGAGGCCTGCGAGGACTGGAAAAAGGGCTC
CGGACTGATATAAAAAGTGGCTTGAGTGTGGATGAGACAAACCTGGACGGAACTGTCAGCTTTGACGAGGTGGTC
ACACCCACCACACCTGCCTCGGGAACCAACATGCCCAAGTCTGCCTCTCCGACTAAACCACCGCCACCCACGACC
GAGGGTTCCGTCATAACGCAGCACAACGGAGAGAATTTCGTCGATCGCAGACGTATCTACGGCGATAATAGGCTT
CCAGAGAGGAAATTGAAGACGATCTGGGAGCTGGCATGGATTGCCTACAACGACAAGGTGTTGATCTTATTGACC
ATTGCGGCTATAGTTTCACTTGCTGTGGGAATTCCGCAATCGCTCCACCCAGCAAATCCCGACGAACCTGGCGTC
GAGTGGGTCGAAGGTTTGGCCATTCTCGTGGCCATTATTATCGTGGTGGTGGTCGGTGCAGCCAATGACTGGCAA
AAGGAACAACAGTTCGCAAAACTCAACAAAAAGAAAGAGAATCGACAGGTCAAGGTAAAACGATCCGGCCGAACC
GAGGAAATTTCTGTCCACGACGTCTTGGTTGGCGATGTGATGTTTTTGGAACCCGGTGATATGGTCCCAGTTGAT
GGGATCTTGATCGATGGTTACGACCTCAAATGCGACGAATCTTCGGCCACTGGCGAGTCTGACGTTCTCCGCAAA
ACCCCCGGCGATGAAGTGTATAAAACAATGGAACAAAACGAAGACCTGAAGAAGATGGATCCTTTCATCATTTCT
GGTGCCAAGGTCTCCGAGGGCGTCGGCACGTTCGTGGTCACTGCTACCGGTACACACGCAACCCTCGGCCGGACG
ATGATGTCCCTCCAAGAGGAGGGCGAAACAACGCCTTTGCAGACGAAGCTCAACAAGTTGGCCGAGTACATTGCC
AAGCTCGGCCTCGCTTCTGGTTTGTTGCTGTTTGTGGTTCTCTTCATCAAATTTTTGGTTCGTCTTAAGGACATC
GCGGGTGGTCCGGACGCCAAGGGTCAAGCATTCCTGCAGATTTTCATTGTTGCTGTCACAATTGTCGTCGTCGCG
GTACCCGAAGGCCTACCACTGGCCGTCACGCTCGCTCTCGCCTTTGCTACAACCCGAATGCTCAAAGACAACAAC
TTGGTTCGCTACCTCAAAGCCTGCGAGACTATGGGTAACGCTACCACGATTTGCTCGGACAAAACTGGAACCTTG
ACGGAGAATAAAATGACTGCAGTGGCTGCGACGTTGGGTACCACGTCTCGGTTCGGCAAGTATTCTGGTGTCTCG
AGCGATGATCAGAGTGAAATCACTCCCTCGGATTTTGTCTCTTCCCTATCACCGTCGGTGAAGGATGTCCTCCTC
AAGTCCATTGTCTACAACTCAACCGCATTTGAAGGTGAGACAGATGGAGTCAAGACGTACGTCGGATCCAAGACA
GAGACTGCTCTCTTGACTTTCGCTAGGGATTACCTTGGATTGGGGCCCCTTGGCGAAGCGAGAGCAAATGGCAAG
GTCGTCCAGATGTTCCCGTTCGATTCTGGCCGCAAATGCATGGCAGTCGTGACGCAGCTGGAGAATGGAAAATAC
CGAATGCTAGTTAAGGGTGCCGCGGAAATTCTATCCCACAAGTCGACTCGTATCGTCCAAGACCCCACTGACACT
CTGTCGGAGACTCCTGTCACCGATGAGAACAGGACTGCACTGGACAGCATTATGACCACCTACGCCACTCGTTCT
CTCAGATGCATTGCGCTGGTTTACCGTGACTTCGATCAATGGCCACCTCGTGGAGCCCCTACTTCGGAAACCGAT
GATACCCAGGCAGTCTTCGAACCTATCTTCAAGGACATGGCAATGTTGGGAATCTTCGGTATTCAGGATCCTGTC
CGAGCCGGTGTTGCCGAGGCAGTGTATACTTGCCAACGTGCTGGAGTGTTTGTCAGAATGGTGACTGGTGATAAC
ATTATGACCGCCAAGGCTATTGCCCAGGAGTGTGGTATCTACACACCTGGCGGTATCGCCATTGAGGGACCCAAA
TTCCGCAAGCTGAGCACACGTCAAATGAACCAAATCATCCCAAGACTCCAGGTCATCGCCCGCTCTAGCCCGGAA
GATAAGAAGATTCTGGTCAATCAACTCAAGAAGCTTGGAGAGACTGTTGCTGTCACTGGAGATGGTACTAACGAC
GCCCCTGCCCTCAAGAATGCCGATGTTGGTTTTGCAATGGGTATCACTGGTACCGAAGTTGCCAAAGAGGCCTCC
GACATTATTCTCATGGATGACAACTTCTCATCGATTGTCAAGGCTATGGCATGGGGTCGCACTGTCTGTGACGCC
GTGAAGAAGTTCCTTCAGTTCCAAATCACTGTCAACATCACCGCCGTCATTCTGACCTTCGTCTCTGCAGTCGCT
AGTGATAATGAGGACTCCGTGCTCAGCGCAGTGCAGTTGCTGTGGGTCAATCTGATCATGGACACGTTTGCCGCT
CTCGCTTTGGCGACAGACCCTCCTACAGAAACAGTGCTTGACCGCAGACCCGAGTCGAAATCCGATCCACTCATC
ACTCTGACAATGTGGAAGATGATCATTGGACAGTCCATCTACCAGCTGGTTGTAACTTTCGTTCTGAATTTCGCC
GGAGATAAGATTTTCTCTTGGGATAGCGGCCATTTGCAGACCGTGGTCTTCAACACTTTCGTGTTTATGCAGATT
TTCAACCAGTACAACTCCCGTCGTATTGACAACAAGCTCAACATTTTGGAAGGTATTTTGAGAAACCGTTGGTTC
ATTGGTATTCAGATCATCATTATTGGGGGTCAAATCTTGATCATCTTCTTTGGTGGCGCTGCTTTCTCCGTCAAG
CGTCTTAACGAAGGCTCGCAGTGGGCCGTGAGTCTTGTGCTCGGAGCAATCTCCATACCCATCGCTGTGATCATT
CGTCTTATTCCGGATGAATTCATCTCGAGACTTATTCCTCACTTCTGGAATCGCAACAAGGGTCCCGCATTGGTC
ATCTCAGACGAGGATCGCAATTACGAGTGGAACCCCGCTCTGGAAGAGATCCGCGACCAGCTCGCCTTCCTCAAG
CGCGTCCGCGGTGGCCGTCTGCGACACCTCCGCCACAAGCTACAGCACCCTCAGGAATTCCTTCCTCGGTCCCGC
AGTGGCTCCCGCTCGCGTGATTCCTCCACGCCACCCACACCGAATGGCGACAATGACCACGAAAACGACAACGGC
AGCCCACAGCCGACCACCCCAGAGTCTCGTTCCAGACGCAACACACGGTCGCGCTCGAACTCGACATTCGGACCC
GCCGCTGCCATGGCAGGTATCGTTGCCGGCAGTATTGCCGGATGGTCTCCGATCGAGCGAGGCCACGATGAGCCC
GAACAAGTCACTTTCCCAACCAACGGGGGCCCTCACAGCGGCCTTGATCGCGAGCCAGGCATTGAGATCCACCCA
GACACCGCTGCCGATGATCGCATCCTGAACGAGTACTCCCCTGACTCCAAGACACCCCCGAGTCAGAACCCAGAT
CTGATTCCGTTCTTCGAGCATGCTCCGCCGGACCGCGCGCCCTCCAGCCGTGGCCGTCGGTCCTTGTCTCAGCGC
TCGAGATCGAGATCGAGTCTCAGTCAGTCGCACGTCTGA
Transcript >Pro_DTO377G3_2|g1921.t1
ATGTCCGACCCACGCTCAAAAGATGAGCCCGGCCAATCGTCAACCCTGCGCAGGGAGCGCGCGCCGACTATTACT
ATCGACACCTCGGCCGTGAACCCCCCGGATAACGAATACACGCCTTTACAAATCCGCTCGGGAGGATCACGGATG
TACACTGATAACGCACATGCCCCCGATACAACCGCACTGCTAAGCAATGGCAGTCGCAATGGCAGTGCCTCTTCT
ACGGATATGCATTCCACAGCATCAATTCGCTCCAATGCATCCTCCGAAGCTCGGGACCGAGAGAGCCGGCCAACC
TCACCTCACAACATCTCATCGCCCAAGACGAAGGCGGCCGAGACACATTCCAACTTCCTTTCCGTCCCTGGAACA
CGCTCGAGAGGCAACTCGTTGGAGTCGGAGGAGACCAACCAAACATCGAGCACCTACGGCGGCGACACATATGTG
CCCTCATCATCTCAGGAATCCGCATCCGATTCGCCTAAAAGTCCCGCCACAAACGGCGTTCACGATGAGGATCCC
CTGTCCCCAGACCCCGGCCGCGAAGACGAGTTTGAGGTCGAGGATAACAAGTTTGCCTTTTCCCCTGGTCAGCTG
AACAAGCTTCTCAATCCGAAGAGCTTTGGCGCCTTCCATGCGTTGGGAGGCCTGCGAGGACTGGAAAAAGGGCTC
CGGACTGATATAAAAAGTGGCTTGAGTGTGGATGAGACAAACCTGGACGGAACTGTCAGCTTTGACGAGGTGGTC
ACACCCACCACACCTGCCTCGGGAACCAACATGCCCAAGTCTGCCTCTCCGACTAAACCACCGCCACCCACGACC
GAGGGTTCCGTCATAACGCAGCACAACGGAGAGAATTTCGTCGATCGCAGACGTATCTACGGCGATAATAGGCTT
CCAGAGAGGAAATTGAAGACGATCTGGGAGCTGGCATGGATTGCCTACAACGACAAGGTGTTGATCTTATTGACC
ATTGCGGCTATAGTTTCACTTGCTGTGGGAATTCCGCAATCGCTCCACCCAGCAAATCCCGACGAACCTGGCGTC
GAGTGGGTCGAAGGTTTGGCCATTCTCGTGGCCATTATTATCGTGGTGGTGGTCGGTGCAGCCAATGACTGGCAA
AAGGAACAACAGTTCGCAAAACTCAACAAAAAGAAAGAGAATCGACAGGTCAAGGTAAAACGATCCGGCCGAACC
GAGGAAATTTCTGTCCACGACGTCTTGGTTGGCGATGTGATGTTTTTGGAACCCGGTGATATGGTCCCAGTTGAT
GGGATCTTGATCGATGGTTACGACCTCAAATGCGACGAATCTTCGGCCACTGGCGAGTCTGACGTTCTCCGCAAA
ACCCCCGGCGATGAAGTGTATAAAACAATGGAACAAAACGAAGACCTGAAGAAGATGGATCCTTTCATCATTTCT
GGTGCCAAGGTCTCCGAGGGCGTCGGCACGTTCGTGGTCACTGCTACCGGTACACACGCAACCCTCGGCCGGACG
ATGATGTCCCTCCAAGAGGAGGGCGAAACAACGCCTTTGCAGACGAAGCTCAACAAGTTGGCCGAGTACATTGCC
AAGCTCGGCCTCGCTTCTGGTTTGTTGCTGTTTGTGGTTCTCTTCATCAAATTTTTGGTTCGTCTTAAGGACATC
GCGGGTGGTCCGGACGCCAAGGGTCAAGCATTCCTGCAGATTTTCATTGTTGCTGTCACAATTGTCGTCGTCGCG
GTACCCGAAGGCCTACCACTGGCCGTCACGCTCGCTCTCGCCTTTGCTACAACCCGAATGCTCAAAGACAACAAC
TTGGTTCGCTACCTCAAAGCCTGCGAGACTATGGGTAACGCTACCACGATTTGCTCGGACAAAACTGGAACCTTG
ACGGAGAATAAAATGACTGCAGTGGCTGCGACGTTGGGTACCACGTCTCGGTTCGGCAAGTATTCTGGTGTCTCG
AGCGATGATCAGAGTGAAATCACTCCCTCGGATTTTGTCTCTTCCCTATCACCGTCGGTGAAGGATGTCCTCCTC
AAGTCCATTGTCTACAACTCAACCGCATTTGAAGGTGAGACAGATGGAGTCAAGACGTACGTCGGATCCAAGACA
GAGACTGCTCTCTTGACTTTCGCTAGGGATTACCTTGGATTGGGGCCCCTTGGCGAAGCGAGAGCAAATGGCAAG
GTCGTCCAGATGTTCCCGTTCGATTCTGGCCGCAAATGCATGGCAGTCGTGACGCAGCTGGAGAATGGAAAATAC
CGAATGCTAGTTAAGGGTGCCGCGGAAATTCTATCCCACAAGTCGACTCGTATCGTCCAAGACCCCACTGACACT
CTGTCGGAGACTCCTGTCACCGATGAGAACAGGACTGCACTGGACAGCATTATGACCACCTACGCCACTCGTTCT
CTCAGATGCATTGCGCTGGTTTACCGTGACTTCGATCAATGGCCACCTCGTGGAGCCCCTACTTCGGAAACCGAT
GATACCCAGGCAGTCTTCGAACCTATCTTCAAGGACATGGCAATGTTGGGAATCTTCGGTATTCAGGATCCTGTC
CGAGCCGGTGTTGCCGAGGCAGTGTATACTTGCCAACGTGCTGGAGTGTTTGTCAGAATGGTGACTGGTGATAAC
ATTATGACCGCCAAGGCTATTGCCCAGGAGTGTGGTATCTACACACCTGGCGGTATCGCCATTGAGGGACCCAAA
TTCCGCAAGCTGAGCACACGTCAAATGAACCAAATCATCCCAAGACTCCAGGTCATCGCCCGCTCTAGCCCGGAA
GATAAGAAGATTCTGGTCAATCAACTCAAGAAGCTTGGAGAGACTGTTGCTGTCACTGGAGATGGTACTAACGAC
GCCCCTGCCCTCAAGAATGCCGATGTTGGTTTTGCAATGGGTATCACTGGTACCGAAGTTGCCAAAGAGGCCTCC
GACATTATTCTCATGGATGACAACTTCTCATCGATTGTCAAGGCTATGGCATGGGGTCGCACTGTCTGTGACGCC
GTGAAGAAGTTCCTTCAGTTCCAAATCACTGTCAACATCACCGCCGTCATTCTGACCTTCGTCTCTGCAGTCGCT
AGTGATAATGAGGACTCCGTGCTCAGCGCAGTGCAGTTGCTGTGGGTCAATCTGATCATGGACACGTTTGCCGCT
CTCGCTTTGGCGACAGACCCTCCTACAGAAACAGTGCTTGACCGCAGACCCGAGTCGAAATCCGATCCACTCATC
ACTCTGACAATGTGGAAGATGATCATTGGACAGTCCATCTACCAGCTGGTTGTAACTTTCGTTCTGAATTTCGCC
GGAGATAAGATTTTCTCTTGGGATAGCGGCCATTTGCAGACCGTGGTCTTCAACACTTTCGTGTTTATGCAGATT
TTCAACCAGTACAACTCCCGTCGTATTGACAACAAGCTCAACATTTTGGAAGGTATTTTGAGAAACCGTTGGTTC
ATTGGTATTCAGATCATCATTATTGGGGGTCAAATCTTGATCATCTTCTTTGGTGGCGCTGCTTTCTCCGTCAAG
CGTCTTAACGAAGGCTCGCAGTGGGCCGTGAGTCTTGTGCTCGGAGCAATCTCCATACCCATCGCTGTGATCATT
CGTCTTATTCCGGATGAATTCATCTCGAGACTTATTCCTCACTTCTGGAATCGCAACAAGGGTCCCGCATTGGTC
ATCTCAGACGAGGATCGCAATTACGAGTGGAACCCCGCTCTGGAAGAGATCCGCGACCAGCTCGCCTTCCTCAAG
CGCGTCCGCGGTGGCCGTCTGCGACACCTCCGCCACAAGCTACAGCACCCTCAGGAATTCCTTCCTCGGTCCCGC
AGTGGCTCCCGCTCGCGTGATTCCTCCACGCCACCCACACCGAATGGCGACAATGACCACGAAAACGACAACGGC
AGCCCACAGCCGACCACCCCAGAGTCTCGTTCCAGACGCAACACACGGTCGCGCTCGAACTCGACATTCGGACCC
GCCGCTGCCATGGCAGGTATCGTTGCCGGCAGTATTGCCGGATGGTCTCCGATCGAGCGAGGCCACGATGAGCCC
GAACAAGTCACTTTCCCAACCAACGGGGGCCCTCACAGCGGCCTTGATCGCGAGCCAGGCATTGAGATCCACCCA
GACACCGCTGCCGATGATCGCATCCTGAACGAGTACTCCCCTGACTCCAAGACACCCCCGAGTCAGAACCCAGAT
CTGATTCCGTTCTTCGAGCATGCTCCGCCGGACCGCGCGCCCTCCAGCCGTGGCCGTCGGTCCTTGTCTCAGCGC
TCGAGATCGAGATCGAGTCTCAGTCAGTCGCACGTCTGA
Gene >Pro_DTO377G3_2|g1921.t1
ATGTCCGACCCACGCTCAAAAGATGAGCCCGGCCAATCGTCAACCCTGCGCAGGGAGCGCGCGCCGACTATTACT
ATCGACACCTCGGCCGTGAACCCCCCGGATAACGAATACACGCCTTTACAAATCCGCTCGGGAGGATCACGGATG
TACACTGATAACGCACATGCCCCCGATACAACCGCACTGCTAAGCAATGGCAGTCGCAATGGCAGTGCCTCTTCT
ACGGATATGCATTCCACAGCATCAATTCGCTCCAATGCATCCTCCGAAGCTCGGGACCGAGAGAGCCGGCCAACC
TCACCTCACAACATCTCATCGCCCAAGACGAAGGCGGCCGAGACACATTCCAACTTCCTTTCCGTCCCTGGAACA
CGCTCGAGAGGCAACTCGTTGGAGTCGGAGGAGACCAACCAAACATCGAGCACCTACGGCGGCGACACATATGTG
CCCTCATCATCTCAGGAATCCGCATCCGATTCGCCTAAAAGTCCCGCCACAAACGGCGTTCACGATGAGGATCCC
CTGTCCCCAGACCCCGGCCGCGAAGACGAGTTTGAGGTCGAGGATAACAAGTTTGCCTTTTCCCCTGGTCAGCTG
AACAAGCTTCTCAATCCGAAGAGCTTTGGCGCCTTCCATGCGTTGGGAGGCCTGCGAGGACTGGAAAAAGGGCTC
CGGACTGATATAAAAAGTGGCTTGAGTGTGGATGAGACAAACCTGGACGGAACTGTCAGCTTTGACGAGGTGGTC
ACACCCACCACACCTGCCTCGGGAACCAACATGCCCAAGTCTGCCTCTCCGACTAAACCACCGCCACCCACGACC
GAGGGTTCCGTCATAACGCAGCACAACGGAGAGAATTTCGTCGATCGCAGACGTATCTACGGCGATAATAGGCTT
CCAGAGAGGAAATTGAAGACGATCTGGGAGCTGGCATGGATTGCCTACAACGACAAGGTGTTGATCTTATTGACC
ATTGCGGCTATAGTTTCACTTGCTGTGGGAATTCCGCAATCGCTCCACCCAGCAAATCCCGACGAACCTGGCGTC
GAGTGGGTCGAAGGTTTGGCCATTCTCGTGGCCATTATTATCGTGGTGGTGGTCGGTGCAGCCAATGACTGGCAA
AAGGAACAACAGTTCGCAAAACTCAACAAAAAGAAAGAGAATCGACAGGTCAAGGTAAAACGATCCGGCCGAACC
GAGGAAATTTCTGTCCACGACGTCTTGGTTGGCGATGTGATGTTTTTGGAACCCGGTGATATGGTCCCAGTTGAT
GGGATCTTGATCGATGGTTACGACCTCAAATGCGACGAATCTTCGGCCACTGGCGAGTCTGACGTTCTCCGCAAA
ACCCCCGGCGATGAAGTGTATAAAACAATGGAACAAAACGAAGACCTGAAGAAGATGGATCCTTTCATCATTTCT
GGTGCCAAGGTCTCCGAGGGCGTCGGCACGTTCGTGGTCACTGCTACCGGTACACACGCAACCCTCGGCCGGACG
ATGATGTCCCTCCAAGAGGAGGGCGAAACAACGCCTTTGCAGACGAAGCTCAACAAGTTGGCCGAGTACATTGCC
AAGCTCGGCCTCGCTTCTGGTTTGTTGCTGTTTGTGGTTCTCTTCATCAAATTTTTGGTTCGTCTTAAGGACATC
GCGGGTGGTCCGGACGCCAAGGGTCAAGCATTCCTGCAGATTTTCATTGTTGCTGTCACAATTGTCGTCGTCGCG
GTACCCGAAGGCCTACCACTGGCCGTCACGCTCGCTCTCGCCTTTGCTACAACCCGAATGCTCAAAGACAACAAC
TTGGTTCGCTACCTCAAAGCCTGCGAGACTATGGGTAACGCTACCACGATTTGCTCGGACAAAACTGGAACCTTG
ACGGAGAATAAAATGACTGCAGTGGCTGCGACGTTGGGTACCACGTCTCGGTTCGGCAAGTATTCTGGTGTCTCG
AGCGATGATCAGAGTGAAATCACTCCCTCGGATTTTGTCTCTTCCCTATCACCGTCGGTGAAGGATGTCCTCCTC
AAGTCCATTGTCTACAACTCAACCGCATTTGAAGGTGAGACAGATGGAGTCAAGACGTACGTCGGATCCAAGACA
GAGACTGCTCTCTTGACTTTCGCTAGGGATTACCTTGGATTGGGGCCCCTTGGCGAAGCGAGAGCAAATGGCAAG
GTCGTCCAGATGTTCCCGTTCGATTCTGGCCGCAAATGCATGGCAGTCGTGACGCAGCTGGAGAATGGAAAATAC
CGAATGCTAGTTAAGGGTGCCGCGGAAATTCTATCCCACAAGTCGACTCGTATCGTCCAAGACCCCACTGACACT
CTGTCGGAGACTCCTGTCACCGATGAGAACAGGACTGCACTGGACAGCATTATGACCACCTACGCCACTCGTTCT
CTCAGATGCATTGCGCTGGTTTACCGTGACTTCGATCAATGGCCACCTCGTGGAGCCCCTACTTCGGAAACCGAT
GATACCCAGGCAGTCTTCGAACCTATCTTCAAGGACATGGCAATGTTGGGAATCTTCGGTATTCAGGATCCTGTC
CGAGCCGGTGTTGCCGAGGCAGTGTATACTTGCCAACGTGCTGGAGTGTTTGTCAGAATGGTGACTGGTGATAAC
ATTATGACCGCCAAGGCTATTGCCCAGGAGTGTGGTATCTACACACCTGGCGGTATCGCCATTGAGGGACCCAAA
TTCCGCAAGCTGAGCACACGTCAAATGAACCAAATCATCCCAAGACTCCAGGTCATCGCCCGCTCTAGCCCGGAA
GATAAGAAGATTCTGGTCAATCAACTCAAGAAGCTTGGAGAGACTGTTGCTGTCACTGGAGATGGTACTAACGAC
GCCCCTGCCCTCAAGAATGCCGATGTTGGTTTTGCAATGGGTATCACTGGTACCGAAGTTGCCAAAGAGGCCTCC
GACATTATTCTCATGGATGACAACTTCTCATCGATTGTCAAGGCTATGGCATGGGGTCGCACTGTCTGTGACGCC
GTGAAGAAGTTCCTTCAGTTCCAAATCACTGTCAACATCACCGCCGTCATTCTGACCTTCGTCTCTGCAGTCGCT
AGTGATAATGAGGACTCCGTGCTCAGCGCAGTGCAGTTGCTGTGGGTCAATCTGATCATGGACACGTTTGCCGCT
CTCGCTTTGGCGACAGACCCTCCTACAGAAACAGTGCTTGACCGCAGACCCGAGTCGAAATCCGATCCACTCATC
ACTCTGACAATGTGGAAGATGATCATTGGACAGTCCATCTACCAGCTGGTTGTAACTTTCGTTCTGAATTTCGCC
GGAGATAAGATTTTCTCTTGGGATAGCGGCCATTTGCAGACCGTGGTCTTCAACACTTTCGTGTTTATGCAGATT
TTCAACCAGTACAACTCCCGTCGTATTGACAACAAGCTCAACATTTTGGAAGGTATTTTGAGAAACCGTTGGTTC
ATTGGTATTCAGATCATCATTATTGGGGGTCAAATCTTGATCATCTTCTTTGGTGGCGCTGCTTTCTCCGTCAAG
CGTCTTAACGAAGGCTCGCAGTGGGCCGTGAGTCTTGTGCTCGGAGCAATCTCCATACCCATCGCTGTGATCATT
CGTCTTATTCCGGATGAATTCATCTCGAGACTTATTCCTCACTTCTGGAATCGCAACAAGGGTCCCGCATTGGTC
ATCTCAGACGAGGATCGCAATTACGAGTGGAACCCCGCTCTGGAAGAGATCCGCGACCAGCTCGCCTTCCTCAAG
CGCGTCCGCGGTGGCCGTCTGCGACACCTCCGCCACAAGCTACAGCACCCTCAGGAATTCCTTCCTCGGTCCCGC
AGTGGCTCCCGCTCGCGTGATTCCTCCACGCCACCCACACCGAATGGCGACAATGACCACGAAAACGACAACGGC
AGCCCACAGCCGACCACCCCAGAGTCTCGTTCCAGACGCAACACACGGTCGCGCTCGAACTCGACATTCGGACCC
GCCGCTGCCATGGCAGGTATCGTTGCCGGCAGTATTGCCGGATGGTCTCCGATCGAGCGAGGCCACGATGAGCCC
GAACAAGTCACTTTCCCAACCAACGGGGGCCCTCACAGCGGCCTTGATCGCGAGCCAGGCATTGAGATCCACCCA
GACACCGCTGCCGATGATCGCATCCTGAACGAGTACTCCCCTGACTCCAAGACACCCCCGAGTCAGAACCCAGAT
CTGATTCCGTTCTTCGAGCATGCTCCGCCGGACCGCGCGCCCTCCAGCCGTGGCCGTCGGTCCTTGTCTCAGCGC
TCGAGATCGAGATCGAGTCTCAGTCAGTCGCACGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail