Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g191.t1
Gene name
Locationscaffold_01:500297..502272
Strand-
Gene length (bp)1975
Transcript length (bp)1611
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01112 Asparaginase_2 Asparaginase 4.6E-28 12 172
PF01112 Asparaginase_2 Asparaginase 2.8E-17 270 369

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 28.34 16.05 40.62
5d_25C Five days - 25 degrees Celsius 48.54 29.09 67.98
7d_25C Seven days - 25 degrees Celsius 57.91 35.23 80.59
10d_25C Ten days - 25 degrees Celsius 78.01 47.47 108.54
7d_15C Seven days - 15 degrees Celsius 55.56 33.35 77.78
7d_30C Seven days - 30 degrees Celsius 53.78 32.54 75.03

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.016098 yes
3d_25C 7d_25C 0.001804 yes
3d_25C 7d_15C 0.002761 yes
3d_25C 7d_30C 0.003625 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.496487 no
5d_25C 7d_15C 0.630425 no
5d_25C 7d_30C 0.728740 no
5d_25C 10d_25C 0.022165 yes
7d_25C 7d_15C 0.901775 no
7d_25C 7d_30C 0.810685 no
7d_25C 10d_25C 0.185999 no
7d_15C 7d_30C 0.924821 no
7d_15C 10d_25C 0.124180 no
7d_30C 10d_25C 0.084264 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g191.t1
MSQTSGNEGVCAIFIHAGAGFHSHENEHKHLKACEVAALKAMAFLKSGGTAIDAVEAAIMVLEDNPITNAGFGSN
LNAKGVVEGDASIVDHHGLNGAVGAVPNIRNPIMLARKIYDKSNVQLGMSRVPPNFLVGEGAKDFAWEHGMVIMP
DEALISPVALERYQVWAAEVNDYENETRGEMIDPWIRRPMTPLDTRLERLERASQAGAHPTSHAADEEIRNQADP
SFFADVKGRPGASLEHKSQKKAKLANSQLPVQPVSPSFLSRDGSPDAADSEQDEDTITDTVGAIAIDKYGNIAAG
SSSGGIGMKHRGRIGPAALIGIGTHVIPQDPSDVDGTTCAVVTSGTGELIASTLAASTCAQRMYYSQKMGDNGLF
TQVMEEEAIRAWMKREFNEHPAVSNSVLFGALGVVVVKKNNSGIELYFAHNTDSFAIASMEVVESGLQITNCNSL
WMRTTTILQRSLFALLTYGLLVLIDGRGSFRPQSPVSASVQSLPSEISALVYPILHCFPWPYTIDVFHGDRMTRR
AIASSDISCSP*
Coding >Pro_DTO377G3_2|g191.t1
ATGTCGCAAACCTCCGGGAATGAGGGCGTTTGTGCCATATTTATTCATGCTGGGGCGGGCTTCCACAGCCACGAG
AATGAGCACAAGCATTTGAAAGCCTGTGAAGTCGCCGCACTCAAGGCTATGGCATTCTTAAAGAGTGGTGGCACC
GCCATTGACGCCGTCGAAGCAGCCATAATGGTGCTTGAAGATAACCCGATTACAAATGCAGGGTTTGGAAGCAAC
TTGAACGCAAAGGGGGTTGTTGAAGGCGATGCCTCAATTGTCGATCATCATGGGCTAAATGGAGCGGTTGGAGCT
GTGCCCAACATCAGGAATCCAATCATGCTTGCTCGGAAGATTTATGATAAGTCTAATGTACAGCTGGGCATGTCA
AGGGTGCCCCCTAACTTCTTGGTTGGAGAAGGTGCCAAGGACTTTGCATGGGAACATGGCATGGTGATCATGCCC
GATGAAGCCTTGATCTCGCCCGTCGCTCTAGAGCGTTATCAGGTATGGGCCGCAGAAGTCAATGATTATGAAAAT
GAAACCCGTGGCGAAATGATCGATCCCTGGATTCGCCGGCCCATGACTCCCCTTGACACTCGCCTTGAACGTCTC
GAGCGTGCTTCTCAAGCAGGAGCTCATCCGACCAGCCATGCAGCAGACGAAGAAATCAGAAACCAGGCCGATCCA
AGCTTTTTTGCGGATGTGAAGGGGCGCCCGGGAGCATCGCTGGAGCATAAAAGTCAGAAAAAGGCCAAGCTCGCG
AACTCACAGCTACCTGTGCAACCTGTCTCCCCCTCATTCTTATCTCGGGATGGTAGCCCCGATGCCGCCGATAGT
GAACAAGACGAGGATACGATTACAGACACTGTTGGCGCGATTGCCATTGATAAGTATGGAAACATTGCAGCGGGA
TCTTCTTCTGGTGGCATTGGCATGAAGCACCGAGGTCGAATTGGTCCTGCAGCCCTAATTGGCATTGGCACCCAT
GTTATTCCACAAGACCCATCTGATGTGGATGGAACTACATGTGCAGTTGTTACATCTGGGACTGGAGAGCTTATT
GCCTCAACACTGGCGGCAAGCACTTGTGCGCAAAGGATGTATTACAGTCAGAAGATGGGCGACAATGGCCTTTTT
ACCCAGGTGATGGAGGAAGAAGCTATCAGGGCATGGATGAAAAGGGAGTTTAACGAACACCCTGCCGTGAGCAAC
AGCGTCCTCTTTGGAGCCCTTGGGGTGGTCGTTGTGAAGAAAAACAATTCGGGCATCGAACTCTACTTTGCCCAC
AACACCGACTCTTTTGCCATTGCCTCGATGGAGGTTGTCGAATCAGGTTTGCAAATAACTAATTGCAATTCACTC
TGGATGCGAACTACAACTATCTTGCAGCGAAGCCTCTTTGCTCTGCTGACTTATGGTCTGTTGGTACTCATCGAT
GGACGAGGTAGCTTTCGCCCACAATCACCTGTATCTGCCTCAGTCCAGTCTCTCCCATCTGAAATCTCTGCCTTG
GTATACCCGATTCTCCATTGTTTTCCTTGGCCTTACACCATTGATGTCTTCCACGGTGACAGGATGACAAGACGA
GCGATTGCTTCATCGGATATTTCTTGCTCTCCCTAG
Transcript >Pro_DTO377G3_2|g191.t1
ATGTCGCAAACCTCCGGGAATGAGGGCGTTTGTGCCATATTTATTCATGCTGGGGCGGGCTTCCACAGCCACGAG
AATGAGCACAAGCATTTGAAAGCCTGTGAAGTCGCCGCACTCAAGGCTATGGCATTCTTAAAGAGTGGTGGCACC
GCCATTGACGCCGTCGAAGCAGCCATAATGGTGCTTGAAGATAACCCGATTACAAATGCAGGGTTTGGAAGCAAC
TTGAACGCAAAGGGGGTTGTTGAAGGCGATGCCTCAATTGTCGATCATCATGGGCTAAATGGAGCGGTTGGAGCT
GTGCCCAACATCAGGAATCCAATCATGCTTGCTCGGAAGATTTATGATAAGTCTAATGTACAGCTGGGCATGTCA
AGGGTGCCCCCTAACTTCTTGGTTGGAGAAGGTGCCAAGGACTTTGCATGGGAACATGGCATGGTGATCATGCCC
GATGAAGCCTTGATCTCGCCCGTCGCTCTAGAGCGTTATCAGGTATGGGCCGCAGAAGTCAATGATTATGAAAAT
GAAACCCGTGGCGAAATGATCGATCCCTGGATTCGCCGGCCCATGACTCCCCTTGACACTCGCCTTGAACGTCTC
GAGCGTGCTTCTCAAGCAGGAGCTCATCCGACCAGCCATGCAGCAGACGAAGAAATCAGAAACCAGGCCGATCCA
AGCTTTTTTGCGGATGTGAAGGGGCGCCCGGGAGCATCGCTGGAGCATAAAAGTCAGAAAAAGGCCAAGCTCGCG
AACTCACAGCTACCTGTGCAACCTGTCTCCCCCTCATTCTTATCTCGGGATGGTAGCCCCGATGCCGCCGATAGT
GAACAAGACGAGGATACGATTACAGACACTGTTGGCGCGATTGCCATTGATAAGTATGGAAACATTGCAGCGGGA
TCTTCTTCTGGTGGCATTGGCATGAAGCACCGAGGTCGAATTGGTCCTGCAGCCCTAATTGGCATTGGCACCCAT
GTTATTCCACAAGACCCATCTGATGTGGATGGAACTACATGTGCAGTTGTTACATCTGGGACTGGAGAGCTTATT
GCCTCAACACTGGCGGCAAGCACTTGTGCGCAAAGGATGTATTACAGTCAGAAGATGGGCGACAATGGCCTTTTT
ACCCAGGTGATGGAGGAAGAAGCTATCAGGGCATGGATGAAAAGGGAGTTTAACGAACACCCTGCCGTGAGCAAC
AGCGTCCTCTTTGGAGCCCTTGGGGTGGTCGTTGTGAAGAAAAACAATTCGGGCATCGAACTCTACTTTGCCCAC
AACACCGACTCTTTTGCCATTGCCTCGATGGAGGTTGTCGAATCAGGTTTGCAAATAACTAATTGCAATTCACTC
TGGATGCGAACTACAACTATCTTGCAGCGAAGCCTCTTTGCTCTGCTGACTTATGGTCTGTTGGTACTCATCGAT
GGACGAGGTAGCTTTCGCCCACAATCACCTGTATCTGCCTCAGTCCAGTCTCTCCCATCTGAAATCTCTGCCTTG
GTATACCCGATTCTCCATTGTTTTCCTTGGCCTTACACCATTGATGTCTTCCACGGTGACAGGATGACAAGACGA
GCGATTGCTTCATCGGATATTTCTTGCTCTCCCTAG
Gene >Pro_DTO377G3_2|g191.t1
ATGTCGCAAACCTCCGGGAATGAGGGCGTTTGTGCCATATTTATTCATGCTGGGGCGGGCTTCCACAGCCACGAG
AATGAGCACAAGCATTTGAAAGCCTGTGAAGTGTCAGTCTCGGTCTTTTATTTGATGGTTACACAGTCTAATAAG
TGAATTGAATTAGCGCCGCACTCAAGGCTATGGCATTCTTAAAGAGTGGTGGCACCGCCATTGACGCCGTCGAAG
CAGCCATAATGGTGCTTGAAGATAACCCGATTACAAATGCAGGGTTTGGAAGCAACTTGAACGCAAAGGGGGTTG
TTGAAGGCGATGCCTCAATTGTCGATCATCATGGGCTAAATGGAGCGGTTGGAGCTGTGCCCAGTAAGTTTGTTG
TGTCTCTTGCTCAGAAAGTCTTGCCTAACACGTGAGCCTGCTAGACATCAGGAATCCAATCATGCTTGCTCGGAA
GATTTATGATAAGTCTAATGTACAGCTGGGCATGTCAAGGGTGCCCCCTAACTTCTTGGTTGGAGAAGGTGCCAA
GGACTTTGCATGGGAACATGGCATGGTGATCATGCCCGATGAAGCCTTGATCTCGCCCGTCGCTCTAGAGCGTTA
TCAGGTATGGGCCGCAGAAGTCAATGATTATGAAAATGAAACCCGTGGCGAAATGATCGATCCCTGGATTCGCCG
GCCCATGACTCCCCTTGACACTCGCCTTGAACGTCTCGAGCGTGCTTCTCAAGCAGGAGCTCATCCGACCAGCCA
TGCAGCAGACGAAGAAATCAGAAACCAGGCCGATCCAAGCTTTTTTGCGGATGTGAAGGGGCGCCCGGGAGCATC
GCTGGAGCATAAAAGTCAGAAAAAGGCCAAGCTCGCGAACTCACAGCTACCTGTGCAACCTGTCTCCCCCTCATT
CTTATCTCGGGATGGTAGCCCCGATGCCGCCGATAGTGAACAAGACGAGGATACGATTACAGACACTGTTGGCGC
GATTGCCATTGATAAGTATGGAAACATTGCAGCGGGATCTTCTTCTGGTGGCATTGGCATGAAGCACCGAGGTCG
AATTGGTCCTGCAGCCCTAATTGGCATTGGCACCCATGTTATTCCACAAGACCCATCTGATGTGGATGGAACTAC
ATGTGCAGTTGTTACATCTGGGACTGGAGAGCTTATTGCCTCAACACTGGCGGCAAGCACTTGTGCGCAAAGGAT
GTATTACAGTCAGAAGATGGGCGACAATGGCCTTTTTACCCAGGTGATGGAGGAAGAAGCTATCAGGGCATGGAT
GAAAAGGGAGTTTAACGGTCCGTTTTCTTCTTTTCGCTGCTTTAATTCTCCAAACACTAACATTTGTTTGCTTGT
CTGTTAGAACACCCTGCCGTGAGCAACAGCGTCCTCTTTGGAGCCCTTGGGGTGGTCGTTGTGAAGAAAAACAAT
TCGGGCATCGAACTCTACTTTGCCCACAACACCGACTCTTTTGTGAGTCTTTCATTATTCATTATTACCATGGTG
CAGGACTGGATGCTAAACATATCTTTCAGGCCATTGCCTCGATGTCTAGCAATTCGAACAGACCTTCTTGTCTGA
TGTCGCGAGGCTCGCGAGGAACCATTGCCCAGGGAGGTTGTCGAATCAGGTTTGCAAATAACTGTAAGTTTCATT
ATTAGGTTGAAGATATAAGCTGTGGATGCTGACAAGGATATGTAATAAGAATTGCAATTCACTCTGGATGCGAAC
TACAACTATCTTGCAGCGAAGCCTCTTTGCTCTGCTGACTTATGGTCTGTTGGTACTCATCGATGGACGAGGTAG
CTTTCGCCCACAATCACCTGTATCTGCCTCAGTCCAGTCTCTCCCATCTGAAATCTCTGCCTTGGTATACCCGAT
TCTCCATTGTTTTCCTTGGCCTTACACCATTGATGTCTTCCACGGTGACAGGATGACAAGACGAGCGATTGCTTC
ATCGGATATTTCTTGCTCTCCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail