Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1904.t1
Gene name
Locationscaffold_02:1128126..1130371
Strand+
Gene length (bp)2245
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 1.1E-39 56 222

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.49 0.0 1.19
5d_25C Five days - 25 degrees Celsius 0.11 0.0 0.35
7d_25C Seven days - 25 degrees Celsius 0.39 0.0 0.96
10d_25C Ten days - 25 degrees Celsius 0.03 0.0 0.18
7d_15C Seven days - 15 degrees Celsius 0.97 0.0 1.99
7d_30C Seven days - 30 degrees Celsius 0.92 0.0 2.10

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 1.000000 no
3d_25C 7d_25C 1.000000 no
3d_25C 7d_15C 0.379309 no
3d_25C 7d_30C 0.488164 no
3d_25C 10d_25C 1.000000 no
5d_25C 7d_25C 1.000000 no
5d_25C 7d_15C 0.144613 no
5d_25C 7d_30C 0.149181 no
5d_25C 10d_25C 1.000000 no
7d_25C 7d_15C 0.254657 no
7d_25C 7d_30C 0.340024 no
7d_25C 10d_25C 1.000000 no
7d_15C 7d_30C 0.964001 no
7d_15C 10d_25C 0.356374 no
7d_30C 10d_25C 0.356374 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1904.t1
MGFPSYCKWAALALAATAAAQTTTSCDPMNKTCPADTGLNKYRLNTDFTAGSLGRWNTTAGTVTTTDLGAKFTIN
EQGDAPTIESEFYIFFGHVDVKMRTANGTGIVSTWILESDDLDEIDWEQISTWDTEAETDYFGKGNTTSYDRGTT
VTVSTPEETFHTYSVDWTAERIEWLLDGVVVRTLEYADAVDGTNYPQTPMRIRIGIWAGGDPDNSEGTIEWAGGE
TDYTEGPFSFYVESVNIINYTPASAYRYTDKTGDYTSIKATNATISTNLSSSNSSSSVASIVQVHGWHGTLDNNY
VALKAYIHNVYNLAFGMQEIQAWSNSFRIYLAISSGTLFSAFFL*
Coding >Pro_DTO377G3_2|g1904.t1
ATGGGCTTCCCGTCTTACTGCAAGTGGGCTGCTCTCGCCTTGGCTGCGACTGCGGCTGCGCAGACTACTACCAGC
TGCGACCCTATGAATAAGACTTGCCCAGCAGACACCGGTCTGAACAAGTACCGTCTCAACACCGACTTCACCGCT
GGATCTCTAGGTCGCTGGAACACCACCGCCGGCACCGTAACCACCACCGACCTAGGCGCCAAGTTCACCATCAAC
GAACAGGGTGACGCGCCGACAATCGAAAGCGAGTTCTACATCTTCTTCGGCCATGTCGACGTCAAGATGAGAACC
GCGAACGGCACCGGTATTGTCAGCACCTGGATCCTCGAGTCCGACGATCTCGACGAGATCGACTGGGAACAAATC
AGTACCTGGGACACTGAAGCCGAAACCGACTACTTCGGAAAAGGCAACACAACCTCCTACGACCGCGGCACAACC
GTAACAGTCTCAACCCCAGAAGAAACATTCCACACCTACTCAGTCGACTGGACCGCCGAGCGCATCGAGTGGCTC
CTGGACGGCGTCGTCGTGCGCACACTCGAGTACGCCGATGCCGTCGACGGCACAAACTACCCCCAAACGCCCATG
CGCATCCGCATCGGCATCTGGGCCGGCGGCGACCCAGATAACTCCGAGGGTACGATCGAGTGGGCCGGCGGCGAG
ACTGACTACACCGAAGGTCCGTTCTCGTTCTACGTTGAGTCGGTCAATATCATCAACTACACCCCGGCTTCCGCG
TACAGGTACACCGATAAGACGGGCGACTACACCAGCATCAAGGCGACGAACGCTACTATCTCTACCAACCTGAGC
TCGTCGAACTCCAGCTCCAGTGTCGCTTCCATTGTCCAAGTACATGGTTGGCATGGAACCTTAGACAACAATTAT
GTCGCATTGAAAGCCTATATCCACAATGTGTACAACCTTGCATTCGGTATGCAGGAAATCCAGGCCTGGAGTAAT
TCCTTCAGGATATATTTGGCCATCTCCTCTGGGACTCTGTTCTCGGCATTCTTTCTCTGA
Transcript >Pro_DTO377G3_2|g1904.t1
ATGGGCTTCCCGTCTTACTGCAAGTGGGCTGCTCTCGCCTTGGCTGCGACTGCGGCTGCGCAGACTACTACCAGC
TGCGACCCTATGAATAAGACTTGCCCAGCAGACACCGGTCTGAACAAGTACCGTCTCAACACCGACTTCACCGCT
GGATCTCTAGGTCGCTGGAACACCACCGCCGGCACCGTAACCACCACCGACCTAGGCGCCAAGTTCACCATCAAC
GAACAGGGTGACGCGCCGACAATCGAAAGCGAGTTCTACATCTTCTTCGGCCATGTCGACGTCAAGATGAGAACC
GCGAACGGCACCGGTATTGTCAGCACCTGGATCCTCGAGTCCGACGATCTCGACGAGATCGACTGGGAACAAATC
AGTACCTGGGACACTGAAGCCGAAACCGACTACTTCGGAAAAGGCAACACAACCTCCTACGACCGCGGCACAACC
GTAACAGTCTCAACCCCAGAAGAAACATTCCACACCTACTCAGTCGACTGGACCGCCGAGCGCATCGAGTGGCTC
CTGGACGGCGTCGTCGTGCGCACACTCGAGTACGCCGATGCCGTCGACGGCACAAACTACCCCCAAACGCCCATG
CGCATCCGCATCGGCATCTGGGCCGGCGGCGACCCAGATAACTCCGAGGGTACGATCGAGTGGGCCGGCGGCGAG
ACTGACTACACCGAAGGTCCGTTCTCGTTCTACGTTGAGTCGGTCAATATCATCAACTACACCCCGGCTTCCGCG
TACAGGTACACCGATAAGACGGGCGACTACACCAGCATCAAGGCGACGAACGCTACTATCTCTACCAACCTGAGC
TCGTCGAACTCCAGCTCCAGTGTCGCTTCCATTGTCCAAGTACATGGTTGGCATGGAACCTTAGACAACAATTAT
GTCGCATTGAAAGCCTATATCCACAATGTGTACAACCTTGCATTCGGTATGCAGGAAATCCAGGCCTGGAGTAAT
TCCTTCAGGATATATTTGGCCATCTCCTCTGGGACTCTGTTCTCGGCATTCTTTCTCTGA
Gene >Pro_DTO377G3_2|g1904.t1
ATGGGCTTCCCGTCTTACTGCAAGTGGGCTGCTCTCGCCTTGGCTGCGACTGCGGCTGCGCAGACTACTACCAGC
TGCGACCCTATGAATAGTATGGACTGTCTCATGTACTTCGCTGCGGACCCGCGCTGACAGTTTGGTTTCAGAGAC
TTGCCCAGCAGACACCGGTCTGAACAAGTACCGTCTCAACACCGACTTCACCGCTGGATCTCTAGGTCGCTGGAA
CACCACCGCCGGCACCGTAACCACCACCGACCTAGGCGCCAAGTTCACCATCAACGAACAGGGTGACGCGCCGAC
AATCGAAAGCGAGTTCTACATCTTCTTCGGCCATGTCGACGTCAAGATGAGAACCGCGAACGGCACCGGTATTGT
CAGCACCTGGATCCTCGAGTCCGACGATCTCGACGAGATCGACTGGGTGAGTTCACCGGCATCAGACGCCACCAA
GCCTCCAATCCCCTCAAATAGCAACCACTAACGCAATACGCAGGAACAAATCAGTACCTGGGACACTGAAGCCGA
AACCGACTACTTCGGAAAAGGCAACACAACCTCCTACGACCGCGGCACAACCGTAACAGTCTCAACCCCAGAAGA
AACATTCCACACCTACTCAGTCGACTGGACCGCCGAGCGCATCGAGTGGCTCCTGGACGGCGTCGTCGTGCGCAC
ACTCGAGTACGCCGATGCCGTCGACGGCACAAACTACCCCCAAACGCCCATGCGCATCCGCATCGGCATCTGGGC
CGGCGGCGACCCAGATAACTCCGAGGGTACGATCGAGTGGGCCGGCGGCGAGACTGACTACACCGAAGGTCCGTT
CTCGTTCTACGTTGAGTCGGTCAATATCATCAACTACACCCCGGCTTCCGCGTACAGGTACACCGATAAGACGGG
CGACTACACCAGCATCAAGGCGACGAACGCTACTATCTCTACCAACCTGAGCTCGTCGAACTCCAGCTCCAGTGT
CGCTTCCAGTAGGACTTCGTCTTCGGCTAAGGCTAGCTCGTCGTTGATTGCTTCTTCGTCGGCGTCGGCTTCTGC
GGCGGCTTCTTCCATGAGTTATGTCTCTGCTGCCCCGGCTTACTATAGTTCTATCTTTGCCATGGCTGTGGGATC
GTTCGTTGCTGGCTTGATGCAGTTTTAGATGGGTGTGTTGAGCATTTAATAGGTCTCGGTGGTTTGGTGATGAGA
CCCGGTCTATTGATATACGCATTATTGTTGCCTTCCAGTCATTCCTTTTGTGAATTGTCTGCCACTTATGCGGCC
TGGCATGTCTTTTTTCGAAGTCTTTTTAGATGCTTTCTTGAATATTCTTTAGATATCTTCTCCCAGAAGCATAAT
TCGCAATATCTACAACATACGCAACTAAAAGTCATGAAATGTGCAAAATGATTTTCCATATATAACATGTGATTG
CTCTGACTGATATTGGTACATGCTATCCTTCTTTCCTTCTGCGTTGAATCCGTACATACACTACATATATATATG
AAGCTACAATGGAATCAAACTGTTTTCTTCTGAGTTAAGGCATATGAAATGAAAAGACAGAGACAAGAATTAGAG
GGGGCAGAGTCGGAAGACGGGATGGCGCAGGGGTAGCCGCGTCAATGTTGACGACACACCGACCCAGCCAACCTT
AGAAATCAATTTCCCGGCCTTAAATCTTTTCACTAGCGCAACAAATGAGGTCTCTACTAAGAGGATGCTTCAACG
CTCGCTTACGTGCAAGAATAATCAGAATCCAGCCGGGAATAAATCCCGCCGATCGCATTCCTGGCAGAGCCTCAC
CGACGACAGCCTTCTAATTGAGACCATCATCAACATTGGACCACCACCAAAGAGAAACCCCGATCCTTTCCAGTG
CATGGAGTCCCAATTATCGAAGCAGACTAGCCAGCCGAAGAAAAACTCAAGTATGTTCGAAGCTAGGCTGGGGCA
GTTGTCCAAGTACATGGTTGGCATGGAACCTTAGGTTTGTCAAGAACAAACAATTTCTTCTTATTCAAGTAGATA
ATAGCTTATAACCACAGAGACAACAATTATGTCGCATTGAAAGCCTATATCCACAAGTTAGTATTTCACCGTGAG
CGCTGCACACCTGGACGTGGGATAATAACCGGCCAGTGTGTACAACCTTGCATTCGGTATGCAGGAAATCCAGGC
CTGGAGTAATTCCTTCAGGATATATTTGGCCATCTCCTCTGGGACTCTGTTCTCGGCATTCTTTCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail