Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1902.t1
Gene name
Locationscaffold_02:1121656..1123306
Strand-
Gene length (bp)1650
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 4.4E-57 57 511
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 7.7E-15 52 111
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.3E-07 44 93
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 8.5E-07 49 86
PF03486 HI0933_like HI0933-like protein 8.8E-07 49 92
PF01494 FAD_binding_3 FAD binding domain 6.9E-05 49 80
PF00890 FAD_binding_2 FAD binding domain 1.4E-04 50 86

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0071949 FAD binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 3.09 0.85 5.34
5d_25C Five days - 25 degrees Celsius 4.18 1.18 7.17
7d_25C Seven days - 25 degrees Celsius 5.03 1.44 8.62
10d_25C Ten days - 25 degrees Celsius 1.50 0.14 2.87
7d_15C Seven days - 15 degrees Celsius 8.54 2.91 14.18
7d_30C Seven days - 30 degrees Celsius 9.18 3.71 14.66

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.536971 no
3d_25C 7d_25C 0.247563 no
3d_25C 7d_15C 0.004840 yes
3d_25C 7d_30C 0.004045 yes
3d_25C 10d_25C 0.134803 no
5d_25C 7d_25C 0.730984 no
5d_25C 7d_15C 0.060388 no
5d_25C 7d_30C 0.033253 yes
5d_25C 10d_25C 0.032181 yes
7d_25C 7d_15C 0.170786 no
7d_25C 7d_30C 0.096313 no
7d_25C 10d_25C 0.009770 yes
7d_15C 7d_30C 0.891073 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1902.t1
MAQSFHLSSPITGINPIKPSNCCSDLAALDKTPRELIEGTHAVRSERKKVIVVGAGVSGLHAAAVLHRHGCEVVV
LEARDRIGGRILTSRKGDHVRDIGAAWMHETSQNSLVKLIPQLSIPYYYDDGVPLYFTRDGRTGSQFKAKKVADE
FADYCEWFYETNPEAEDRPVQEFAREFVLQHQLITEDEREWAPQAIREVELWIGTSTDQASSKHLSYFITERNVY
MKGGYDRIVNWTAETLRSDPNIIRLNHRVEDVEWNEHGTAPARIRYKDAAGEVGFIQGDAVIMTSPLGVYHHNLI
SFNPPLPGDIQEGMSRCSYGALGKVFFEFAEVFWSKENDQFVFYPSPSEETDTSTGSSSSMESNPSINSIGENDN
ILNYATVTINLWIMTGSKELCVQIAEPLTQRIENMQDPKEIYLFFEPLFKIFRTEPYKALPSLVNVETTHWTQDP
LAGYGTYSADKVGDEPQLLVDALKNHKSSRLQFAGEHCTIVGNGCVHGAYKSGETAATNLLEGFGIQYDGLDAIS
LK*
Coding >Pro_DTO377G3_2|g1902.t1
ATGGCTCAATCTTTCCATCTTTCTTCTCCCATAACGGGCATTAATCCCATAAAACCGAGTAATTGTTGCTCCGAC
CTGGCTGCGCTCGATAAGACTCCGAGGGAGTTGATCGAGGGAACACACGCAGTGAGGTCGGAGCGCAAGAAGGTG
ATTGTGGTGGGCGCTGGAGTTTCTGGCCTGCATGCCGCGGCTGTTCTGCACCGCCATGGCTGCGAAGTGGTGGTA
TTAGAAGCACGCGATCGCATTGGTGGAAGAATTTTGACAAGCCGAAAGGGTGACCATGTCCGAGATATTGGTGCC
GCTTGGATGCATGAAACTTCCCAGAACAGCCTGGTGAAACTCATTCCCCAGCTATCTATCCCATATTATTATGAC
GATGGCGTTCCTCTATACTTCACCAGAGACGGCCGAACTGGATCCCAGTTCAAAGCTAAGAAAGTTGCAGACGAG
TTCGCTGATTATTGCGAGTGGTTCTACGAAACTAACCCAGAGGCTGAGGATCGTCCAGTCCAGGAATTTGCGAGA
GAATTCGTTCTCCAGCACCAGCTCATCACCGAAGATGAGCGTGAGTGGGCTCCGCAGGCTATCCGCGAGGTAGAA
TTGTGGATCGGCACTAGTACGGACCAAGCATCGTCCAAACATCTTTCTTACTTCATCACCGAACGCAATGTATAT
ATGAAGGGTGGCTATGATCGGATCGTGAACTGGACTGCGGAGACGCTCCGAAGCGATCCAAACATCATTAGACTC
AACCACCGCGTCGAGGACGTGGAGTGGAACGAACACGGGACGGCACCAGCTCGAATCCGGTACAAGGATGCTGCT
GGAGAAGTCGGGTTCATCCAGGGCGATGCAGTTATCATGACTAGCCCACTGGGGGTCTACCACCACAACCTCATC
TCGTTTAACCCGCCCTTACCGGGTGACATCCAAGAGGGCATGTCTAGGTGCAGCTACGGCGCCTTGGGCAAGGTG
TTTTTCGAATTCGCCGAAGTCTTCTGGTCAAAGGAGAATGATCAGTTTGTCTTCTACCCATCTCCATCAGAGGAA
ACGGACACTTCAACCGGGTCATCATCATCCATGGAGTCCAACCCCAGTATAAACTCGATCGGGGAGAATGATAAT
ATCCTAAATTACGCCACCGTGACAATCAATTTATGGATTATGACGGGCAGCAAAGAGCTGTGCGTACAGATTGCC
GAACCTCTGACGCAGCGCATCGAGAACATGCAAGATCCGAAGGAGATATATCTATTTTTTGAACCGCTTTTCAAG
ATATTCCGCACAGAACCATACAAGGCTTTGCCTAGCCTGGTTAATGTTGAAACTACACATTGGACCCAGGACCCA
CTGGCTGGGTATGGGACTTACTCCGCCGACAAGGTTGGAGATGAGCCGCAGCTGCTGGTTGATGCGTTGAAAAAC
CACAAATCCAGTCGCTTGCAGTTCGCTGGTGAGCATTGTACTATTGTTGGCAATGGCTGCGTGCATGGTGCCTAT
AAGTCGGGTGAAACTGCTGCCACCAATCTGCTCGAGGGCTTTGGCATTCAATATGATGGTCTTGATGCCATCAGT
TTGAAATGA
Transcript >Pro_DTO377G3_2|g1902.t1
ATGGCTCAATCTTTCCATCTTTCTTCTCCCATAACGGGCATTAATCCCATAAAACCGAGTAATTGTTGCTCCGAC
CTGGCTGCGCTCGATAAGACTCCGAGGGAGTTGATCGAGGGAACACACGCAGTGAGGTCGGAGCGCAAGAAGGTG
ATTGTGGTGGGCGCTGGAGTTTCTGGCCTGCATGCCGCGGCTGTTCTGCACCGCCATGGCTGCGAAGTGGTGGTA
TTAGAAGCACGCGATCGCATTGGTGGAAGAATTTTGACAAGCCGAAAGGGTGACCATGTCCGAGATATTGGTGCC
GCTTGGATGCATGAAACTTCCCAGAACAGCCTGGTGAAACTCATTCCCCAGCTATCTATCCCATATTATTATGAC
GATGGCGTTCCTCTATACTTCACCAGAGACGGCCGAACTGGATCCCAGTTCAAAGCTAAGAAAGTTGCAGACGAG
TTCGCTGATTATTGCGAGTGGTTCTACGAAACTAACCCAGAGGCTGAGGATCGTCCAGTCCAGGAATTTGCGAGA
GAATTCGTTCTCCAGCACCAGCTCATCACCGAAGATGAGCGTGAGTGGGCTCCGCAGGCTATCCGCGAGGTAGAA
TTGTGGATCGGCACTAGTACGGACCAAGCATCGTCCAAACATCTTTCTTACTTCATCACCGAACGCAATGTATAT
ATGAAGGGTGGCTATGATCGGATCGTGAACTGGACTGCGGAGACGCTCCGAAGCGATCCAAACATCATTAGACTC
AACCACCGCGTCGAGGACGTGGAGTGGAACGAACACGGGACGGCACCAGCTCGAATCCGGTACAAGGATGCTGCT
GGAGAAGTCGGGTTCATCCAGGGCGATGCAGTTATCATGACTAGCCCACTGGGGGTCTACCACCACAACCTCATC
TCGTTTAACCCGCCCTTACCGGGTGACATCCAAGAGGGCATGTCTAGGTGCAGCTACGGCGCCTTGGGCAAGGTG
TTTTTCGAATTCGCCGAAGTCTTCTGGTCAAAGGAGAATGATCAGTTTGTCTTCTACCCATCTCCATCAGAGGAA
ACGGACACTTCAACCGGGTCATCATCATCCATGGAGTCCAACCCCAGTATAAACTCGATCGGGGAGAATGATAAT
ATCCTAAATTACGCCACCGTGACAATCAATTTATGGATTATGACGGGCAGCAAAGAGCTGTGCGTACAGATTGCC
GAACCTCTGACGCAGCGCATCGAGAACATGCAAGATCCGAAGGAGATATATCTATTTTTTGAACCGCTTTTCAAG
ATATTCCGCACAGAACCATACAAGGCTTTGCCTAGCCTGGTTAATGTTGAAACTACACATTGGACCCAGGACCCA
CTGGCTGGGTATGGGACTTACTCCGCCGACAAGGTTGGAGATGAGCCGCAGCTGCTGGTTGATGCGTTGAAAAAC
CACAAATCCAGTCGCTTGCAGTTCGCTGGTGAGCATTGTACTATTGTTGGCAATGGCTGCGTGCATGGTGCCTAT
AAGTCGGGTGAAACTGCTGCCACCAATCTGCTCGAGGGCTTTGGCATTCAATATGATGGTCTTGATGCCATCAGT
TTGAAATGA
Gene >Pro_DTO377G3_2|g1902.t1
ATGGCTCAATCTTTCCATCTTTCTTCTCCCATAACGGGCATTAATCCCATAAAACCGAGTAATTGTTGCTCCGAC
CTGGCTGCGCTCGATAAGACTCCGAGGGAGTTGATCGAGGGAACACACGCAGTGAGGTCGGAGCGCAAGAAGGTG
ATTGTGGTGGGCGCTGGAGTTTCTGGCCTGCATGCCGCGGCTGTTCTGCACCGCCATGGCTGCGAAGTGGTGGTA
TTAGAAGCACGCGATCGCATTGGTGGAAGAATTTTGACAAGCCGAAAGGGTGACCATGTCCGAGATATTGGTAAG
ATAATGACACAAACCCGAAATCGAGGTTGAAACAGGGGGGGACTGTGCTGATAGTCAATAGGTGCCGCTTGGATG
CATGAAACTTCCCAGAACAGCCTGGTGAAACTCATTCCCCAGCTATCTATCCCATATTATTATGACGATGGCGTT
CCTCTATACTTCACCAGAGACGGCCGAACTGGATCCCAGTTCAAAGCTAAGAAAGTTGCAGACGAGTTCGCTGAT
TATTGCGAGTGGTTCTACGAAACTAACCCAGAGGCTGAGGATCGTCCAGTCCAGGAATTTGCGAGAGAATTCGTT
CTCCAGCACCAGCTCATCACCGAAGATGAGCGTGAGTGGGCTCCGCAGGCTATCCGCGAGGTAGAATTGTGGATC
GGCACTAGTACGGACCAAGCATCGTCCAAACATCTTTCTTACTTCATCACCGAACGCAATGTATATATGAAGGGT
GGCTATGATCGGATCGTGAACTGGACTGCGGAGACGCTCCGAAGCGATCCAAACATCATTAGACTCAACCACCGC
GTCGAGGACGTGGAGTGGAACGAACACGGGACGGCACCAGCTCGAATCCGGTACAAGGATGCTGCTGGAGAAGTC
GGGTTCATCCAGGGCGATGCAGTTATCATGACTAGCCCACTGGGGGTCTACCACCACAACCTCATCTCGTTTAAC
CCGCCCTTACCGGGTGACATCCAAGAGGGCATGTCTAGGTGCAGCTACGGCGCCTTGGGCAAGGTGTTTTTCGAA
TTCGCCGAAGTCTTCTGGTCAAAGGAGAATGATCAGTTTGTCTTCTACCCATCTCCATCAGAGGAAACGGACACT
TCAACCGGGTCATCATCATCCATGGAGTCCAACCCCAGTATAAACTCGATCGGGGAGAATGATAATATCCTAAAT
TACGCCACCGTGACAATCAATTTATGGATTATGACGGGCAGCAAAGAGCTGTGCGTACAGATTGCCGAACCTCTG
ACGCAGCGCATCGAGAACATGCAAGATCCGAAGGAGATATATCTATTTTTTGAACCGCTTTTCAAGATATTCCGC
ACAGAACCATACAAGGCTTTGCCTAGCCTGGTTAATGTTGAAACTACACATTGGACCCAGGACCCACTGGCTGGG
TATGGGACTTACTCCGCCGACAAGGTTGGAGATGAGCCGCAGCTGCTGGTTGATGCGTTGAAAAACCACAAATCC
AGTCGCTTGCAGTTCGCTGGTGAGCATTGTACTATTGTTGGCAATGGCTGCGTGCATGGTGCCTATAAGTCGGGT
GAAACTGCTGCCACCAATCTGCTCGAGGGCTTTGGCATTCAATATGATGGTCTTGATGCCATCAGTTTGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail