Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g190.t1
Gene name
Locationscaffold_01:498836..500022
Strand+
Gene length (bp)1186
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03850 Tfb4 Transcription factor Tfb4 4.1E-120 19 334

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0006289 nucleotide-excision repair Yes
GO:0000439 transcription factor TFIIH core complex Yes
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0044798 nuclear transcription factor complex No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0006950 response to stress No
GO:0033554 cellular response to stress No
GO:0044260 cellular macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006281 DNA repair No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044446 intracellular organelle part No
GO:0071704 organic substance metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0050794 regulation of cellular process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0090304 nucleic acid metabolic process No
GO:0065007 biological regulation No
GO:0046483 heterocycle metabolic process No
GO:0050789 regulation of biological process No
GO:0044464 cell part No
GO:0044428 nuclear part No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0005667 transcription factor complex No
GO:0010468 regulation of gene expression No
GO:0044237 cellular metabolic process No
GO:0050896 response to stimulus No
GO:0019222 regulation of metabolic process No
GO:0044424 intracellular part No
GO:0006259 DNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044422 organelle part No
GO:0090575 RNA polymerase II transcription factor complex No
GO:2001141 regulation of RNA biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0008150 biological_process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0032991 protein-containing complex No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0031326 regulation of cellular biosynthetic process No
GO:0006974 cellular response to DNA damage stimulus No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g190.t1
MNSVDASEHYELGATDLSPSLLTIVIDTNPHAWAALEDSLPLSKAIANILVFINAHLACNYANEVAVVASHSQKA
AWLYPSHDDPRKRTADRDGDVVMNGASDTPAPETNKYRPFRIVEEQVTRNLKELMDSTTGDDLRGNMSTMLAGAL
TLALSHTNRRTLAWAEEHGGANAEDAAADGNGGGGGTSTNRYSASNEDERLQSRILVVSVSGSTDAAHQYIPVMN
SIFACQRLSIPIDVCKLSGDAVFLQQASDATKGVYMALAEPRGLLQYLMMAFLPDQRSRRHLVLPTRVDVDFRAA
CFCHRRVVDVGFVCSICLSIFCEPPPGGDCMTCGTHLDIGDNAKPALLPRKKKKKKRVNGASGTGTPMSTPTPGP
*
Coding >Pro_DTO377G3_2|g190.t1
ATGAATTCCGTGGATGCTTCGGAGCATTATGAGTTAGGAGCTACCGACCTCTCCCCATCCCTGCTCACCATAGTC
ATCGACACAAACCCACACGCCTGGGCCGCACTGGAAGACTCCCTGCCACTCTCTAAAGCAATCGCCAACATCTTA
GTCTTCATCAACGCCCACCTAGCATGCAACTATGCCAACGAAGTCGCCGTAGTCGCATCGCACAGTCAAAAAGCA
GCATGGCTCTACCCATCCCACGATGATCCCCGAAAGCGCACCGCCGATCGCGACGGCGACGTCGTAATGAACGGC
GCAAGCGACACCCCAGCCCCAGAAACGAACAAATACCGCCCCTTCCGCATCGTCGAAGAACAAGTCACCCGCAAT
CTCAAAGAACTAATGGACTCGACGACTGGCGACGATCTACGCGGCAACATGTCCACGATGCTAGCGGGCGCGCTC
ACCCTCGCCCTGAGCCACACCAACCGACGCACACTCGCCTGGGCGGAGGAGCACGGCGGCGCCAACGCCGAAGAT
GCAGCGGCCGATGGCAACGGCGGGGGCGGGGGCACATCCACAAACCGGTACTCAGCCTCGAACGAGGACGAGCGG
CTGCAGAGCCGCATCTTGGTTGTTTCTGTGAGCGGGTCTACCGATGCGGCCCACCAGTATATCCCTGTCATGAAC
AGCATCTTTGCCTGCCAGCGCTTGAGCATCCCCATCGATGTGTGCAAGCTCAGTGGCGATGCGGTCTTCCTTCAG
CAGGCGTCTGATGCTACCAAGGGAGTTTATATGGCTCTCGCCGAGCCGCGAGGCCTGCTGCAGTATCTGATGATG
GCGTTTTTGCCTGATCAGCGCTCACGTCGTCATTTGGTTCTTCCGACTCGGGTGGATGTCGATTTTCGTGCTGCT
TGCTTTTGTCATCGCCGAGTAGTTGATGTTGGCTTCGTCTGCTCCATTTGTCTCAGTATCTTCTGCGAGCCGCCC
CCTGGTGGTGACTGCATGACTTGTGGCACGCATCTGGATATCGGAGACAATGCCAAGCCTGCTCTGTTGCCACGG
AAAAAGAAGAAAAAGAAGCGTGTTAACGGGGCATCCGGAACGGGAACGCCCATGTCGACGCCTACGCCGGGTCCT
TGA
Transcript >Pro_DTO377G3_2|g190.t1
ATGAATTCCGTGGATGCTTCGGAGCATTATGAGTTAGGAGCTACCGACCTCTCCCCATCCCTGCTCACCATAGTC
ATCGACACAAACCCACACGCCTGGGCCGCACTGGAAGACTCCCTGCCACTCTCTAAAGCAATCGCCAACATCTTA
GTCTTCATCAACGCCCACCTAGCATGCAACTATGCCAACGAAGTCGCCGTAGTCGCATCGCACAGTCAAAAAGCA
GCATGGCTCTACCCATCCCACGATGATCCCCGAAAGCGCACCGCCGATCGCGACGGCGACGTCGTAATGAACGGC
GCAAGCGACACCCCAGCCCCAGAAACGAACAAATACCGCCCCTTCCGCATCGTCGAAGAACAAGTCACCCGCAAT
CTCAAAGAACTAATGGACTCGACGACTGGCGACGATCTACGCGGCAACATGTCCACGATGCTAGCGGGCGCGCTC
ACCCTCGCCCTGAGCCACACCAACCGACGCACACTCGCCTGGGCGGAGGAGCACGGCGGCGCCAACGCCGAAGAT
GCAGCGGCCGATGGCAACGGCGGGGGCGGGGGCACATCCACAAACCGGTACTCAGCCTCGAACGAGGACGAGCGG
CTGCAGAGCCGCATCTTGGTTGTTTCTGTGAGCGGGTCTACCGATGCGGCCCACCAGTATATCCCTGTCATGAAC
AGCATCTTTGCCTGCCAGCGCTTGAGCATCCCCATCGATGTGTGCAAGCTCAGTGGCGATGCGGTCTTCCTTCAG
CAGGCGTCTGATGCTACCAAGGGAGTTTATATGGCTCTCGCCGAGCCGCGAGGCCTGCTGCAGTATCTGATGATG
GCGTTTTTGCCTGATCAGCGCTCACGTCGTCATTTGGTTCTTCCGACTCGGGTGGATGTCGATTTTCGTGCTGCT
TGCTTTTGTCATCGCCGAGTAGTTGATGTTGGCTTCGTCTGCTCCATTTGTCTCAGTATCTTCTGCGAGCCGCCC
CCTGGTGGTGACTGCATGACTTGTGGCACGCATCTGGATATCGGAGACAATGCCAAGCCTGCTCTGTTGCCACGG
AAAAAGAAGAAAAAGAAGCGTGTTAACGGGGCATCCGGAACGGGAACGCCCATGTCGACGCCTACGCCGGGTCCT
TGA
Gene >Pro_DTO377G3_2|g190.t1
ATGAATTCCGTGGATGCTTCGGAGCATTATGAGTTAGGAGCTACCGGTCCGTATTCTCTACACTTACAAGAGGCG
AACAACTGGCTAACCATATCGACATCCAGACCTCTCCCCATCCCTGCTCACCATAGTCATCGACACAAACCCACA
CGCCTGGGCCGCACTGGAAGACTCCCTGCCACTCTCTAAAGCAATCGCCAACATCTTAGTCTTCATCAACGCCCA
CCTAGCATGCAACTATGCCAACGAAGTCGCCGTAGTCGCATCGCACAGTCAAAAAGCAGCATGGCTCTACCCATC
CCACGATGATCCCCGAAAGCGCACCGCCGATCGCGACGGCGACGTCGTAATGAACGGCGCAAGCGACACCCCAGC
CCCAGAAACGAACAAATACCGCCCCTTCCGCATCGTCGAAGAACAAGTCACCCGCAATCTCAAAGAACTAATGGA
CTCGACGACTGGCGACGATCTACGCGGCAACATGTCCACGATGCTAGCGGGCGCGCTCACCCTCGCCCTGAGCCA
CACCAACCGACGCACACTCGCCTGGGCGGAGGAGCACGGCGGCGCCAACGCCGAAGATGCAGCGGCCGATGGCAA
CGGCGGGGGCGGGGGCACATCCACAAACCGGTACTCAGCCTCGAACGAGGACGAGCGGCTGCAGAGCCGCATCTT
GGTTGTTTCTGTGAGCGGGTCTACCGATGCGGCCCACCAGTATATCCCTGTCATGAACAGCATCTTTGCCTGCCA
GCGCTTGAGCATCCCCATCGATGTGTGCAAGCTCAGTGGCGATGCGGTCTTCCTTCAGCAGGCGTCTGATGCTAC
CAAGGGAGTTTATATGGCTCTCGCCGAGCCGCGAGGCCTGCTGCAGTATCTGATGATGGCGTTTTTGCCTGATCA
GCGCTCACGTCGTCATTTGGTTCTTCCGACTCGGGTGGATGTCGATTTTCGTGCTGCTTGCTTTTGTCATCGCCG
AGTAGTTGATGTTGGCTTCGTCTGCTCCATTTGTCTCAGTATCTTCTGCGAGCCGCCCCCTGGTGGTGACTGCAT
GACTTGTGGCACGCATCTGGATATCGGAGACAATGCCAAGCCTGCTCTGTTGCCACGGAAAAAGAAGAAAAAGAA
GCGTGTTAACGGGGCATCCGGAACGGGAACGCCCATGTCGACGCCTACGCCGGGTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail