Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g188.t1
Gene name
Locationscaffold_01:490076..493893
Strand-
Gene length (bp)3817
Transcript length (bp)3606
Coding sequence length (bp)3606
Protein length (aa) 1202

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family 2.4E-71 827 1139
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.3E-06 373 444
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.7E-09 466 521
PF13637 Ank_4 Ankyrin repeats (many copies) 2.9E-08 477 517
PF13637 Ank_4 Ankyrin repeats (many copies) 1.2E-06 536 587
PF03105 SPX SPX domain 2.3E-09 1 41
PF03105 SPX SPX domain 1.1E-09 95 145
PF13857 Ank_5 Ankyrin repeats (many copies) 7.2E-08 483 539
PF00023 Ank Ankyrin repeat 1.7E-02 497 521

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006629 lipid metabolic process Yes
GO:0008081 phosphoric diester hydrolase activity Yes
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g188.t1
MKFGRNLPQFTVPEWSGSYIKYKALKKLIKSAAEQIKSGQEPDLAGFFYNLDRNVEDVDHFYNKKYSDFARRLKL
LEERYGYSMDGRHALEPEDRHDLREALLDLRYHLRRLQWYGEVNRRGFVKITKKLDKKVGAQAQKRYLETKVDPA
PFASNERVFQSQDRINAWMAIITDQSKADDKASDDTSSTHSSLSLKRGPTRPYLNLPTSILTAVDDALRKDDTHV
FLELLETLKATADEAGDTVYPRVLRTLIQRSILHRSRAVLNLLLNRVDTLEEDDDINRRNCLHRLVISIGRDQPT
TDAEPAASMVLNFPPETTRYITPAAPPTLQPPRPVVKEEHMPQQLGREDSAVIHFQFLLDSLRPDQRESLMAKDL
AGRTPLHYAAQYGFKVVCEVIIEHLKEWDMFDVSDGIDGPLWQDNDGWAPLHLSVVGGHPKTTRCLLDAEKQHGP
SQGRSIIRKQVSKSSAVLVLATKANFIDIVQLLVDAGVDINYQDEQGETALHVAARFGRDECAQILLDGSDDQKA
DTELAENTYSWTPLFIACVDGSLSVAKMLVSAGADVERFDSSGWTAKEHAALRGHLDIARCLAEVSPGPPATEPD
FSSSTPNLTGSDSSSPPTQSSLTDRRSNAPGPTSGGPGVRSTEPIKTFGHRYLTDESMILVSLGTMDMRKPLETV
SLDRIPMENAHATQLDTSLSMVITASGAHGEPEVIDLPVQDNISTEPIVFHTTDPSKVRLLFDLIPTYAGSKDKI
VGRGVALLSSIKPTVGSHRINLKGDSTVPIVAANTLEVIGSVTFNFLIITPFKHPKMSIAGNQTYWRSMSSTMVI
GHRGLGKNMAGRNSLQLGENTVESFIAAANLGASYVEFDVQLTKDHVPVIYHDFLVSETGIDAPVHTMTLDQFLE
LGIGRYRHSLPGSVKTNGEESELGPRQRSMSVGGSEYNPAELTEKIKHTRDFKKKGFKGNTRGEHIQAPFATLEE
LFRKIPKPVGFNIELKYPMLHESEEEEMDTYAVELNSFVDTILTKVYDLGGGRDILFSSFNPDICLLLSFKQPSI
PVLFLTDAGASPVGDIRASSLQEAIRFASRWNLLGIVTQAEPLVLCPRLVRIVKESGLVCVSYGTLNNEGKNVDY
QVSEGIDAVIVDSVLGITNGLIQRHGKGERTPGTSPNPSAVKDQITNSAKGDVIVPALERVKQTTLSPDMNPPTL
L*
Coding >Pro_DTO377G3_2|g188.t1
ATGAAATTCGGCCGCAATTTGCCGCAGTTCACGGTTCCCGAGTGGAGCGGCTCTTACATCAAGTACAAGGCCCTG
AAGAAGCTGATCAAGTCTGCTGCTGAGCAGATCAAATCGGGACAGGAGCCGGATTTGGCTGGTTTCTTCTACAAC
CTCGACCGAAATGTTGAAGATGTCGATCATTTCTACAACAAGAAATATTCCGACTTCGCCCGCCGTCTGAAGTTG
CTCGAGGAGCGCTATGGCTACTCAATGGATGGTCGCCATGCTCTCGAGCCCGAGGATCGGCATGACCTGCGCGAG
GCCCTGCTGGACCTGCGATACCACTTGCGCCGCTTACAATGGTATGGTGAAGTCAATCGACGTGGCTTCGTCAAG
ATCACCAAGAAGTTGGACAAGAAGGTTGGTGCGCAGGCCCAGAAGCGCTATCTGGAGACGAAGGTCGATCCCGCC
CCGTTCGCCTCCAATGAGCGCGTCTTCCAGTCTCAGGATCGCATCAATGCTTGGATGGCCATCATTACGGACCAG
TCCAAGGCGGACGACAAGGCATCCGATGACACGAGCTCCACCCATTCTTCCCTTTCATTGAAGCGTGGCCCAACT
AGGCCTTATCTTAATCTGCCTACGAGCATTCTCACTGCTGTGGATGATGCCCTGCGCAAGGATGACACTCATGTC
TTCCTTGAACTACTCGAGACTTTGAAGGCCACTGCAGATGAAGCGGGAGACACGGTTTATCCTAGGGTTCTCAGA
ACCCTGATCCAGCGCTCTATCCTTCATCGTTCTCGTGCTGTCCTGAATCTTCTCCTGAACCGGGTGGACACCCTA
GAAGAGGACGATGACATCAACAGACGTAACTGCCTTCACCGTCTGGTCATTTCCATTGGTCGTGACCAGCCTACG
ACTGACGCCGAGCCCGCGGCGTCAATGGTGCTCAACTTCCCTCCGGAGACTACCCGCTATATCACACCCGCGGCA
CCTCCGACCCTCCAACCGCCGCGCCCCGTGGTCAAAGAGGAGCACATGCCCCAGCAGCTGGGTCGCGAGGATTCT
GCTGTTATTCACTTCCAATTTCTCTTAGACTCGCTGCGCCCTGATCAGCGTGAGTCTTTGATGGCCAAAGACCTT
GCTGGACGCACTCCATTGCACTATGCGGCACAGTATGGTTTCAAGGTCGTTTGTGAAGTGATCATTGAGCATCTC
AAAGAATGGGACATGTTCGATGTCAGCGATGGGATCGACGGTCCTCTCTGGCAGGACAATGACGGCTGGGCCCCG
CTTCATTTGAGTGTTGTGGGTGGCCACCCCAAAACCACCCGGTGTCTCTTGGATGCCGAAAAACAGCATGGTCCC
TCGCAGGGGCGGAGCATCATAAGAAAACAGGTCTCGAAGTCTAGTGCAGTATTGGTATTAGCGACCAAGGCCAAC
TTCATTGACATTGTCCAGCTTCTGGTGGATGCTGGTGTCGATATCAATTACCAGGATGAACAGGGAGAAACTGCA
TTGCACGTTGCCGCCCGATTTGGCCGTGACGAGTGCGCCCAAATTCTGCTGGATGGTAGCGACGACCAGAAGGCA
GACACAGAACTAGCTGAAAACACATATAGTTGGACTCCGCTCTTCATTGCCTGTGTGGACGGATCTCTGAGTGTG
GCCAAAATGCTGGTTTCCGCTGGTGCAGATGTGGAGCGTTTCGACTCCTCTGGCTGGACGGCTAAGGAGCACGCG
GCCCTCAGAGGCCATCTTGACATCGCCCGATGCTTGGCAGAAGTTAGCCCTGGCCCTCCTGCCACTGAGCCTGAT
TTTTCATCGTCTACTCCAAACCTCACTGGTTCCGATTCCTCCTCGCCCCCGACTCAGTCGTCCCTCACTGATCGC
CGGTCAAATGCGCCTGGCCCAACTTCTGGAGGTCCTGGCGTACGGTCCACTGAACCTATCAAGACTTTTGGACAC
AGGTATCTCACCGATGAGAGCATGATCTTGGTCAGTCTGGGAACTATGGACATGCGCAAGCCGCTTGAGACAGTC
AGCCTCGACCGCATTCCGATGGAGAATGCACATGCCACCCAGCTAGATACGTCTTTGTCGATGGTGATAACAGCT
AGCGGTGCACATGGTGAGCCGGAGGTGATTGACTTGCCTGTGCAGGACAATATCTCAACCGAGCCAATTGTCTTC
CACACTACCGATCCTAGCAAGGTGCGTCTGCTTTTCGACCTCATCCCCACCTACGCAGGATCGAAGGATAAGATT
GTTGGCCGGGGTGTCGCTCTGCTTTCTAGCATCAAGCCCACTGTCGGGTCGCACCGAATCAACCTCAAAGGTGAT
TCCACTGTTCCCATTGTTGCCGCGAATACCCTTGAGGTGATCGGGTCTGTGACGTTCAACTTCCTTATCATCACG
CCCTTCAAGCACCCGAAAATGTCTATCGCGGGCAACCAGACCTACTGGCGCTCGATGAGCTCCACCATGGTCATT
GGACACCGTGGACTAGGTAAGAATATGGCTGGCCGCAATTCGTTACAGTTGGGCGAGAATACTGTGGAGTCGTTC
ATCGCTGCAGCCAACCTGGGCGCCTCATATGTCGAGTTCGATGTACAGCTCACGAAAGACCATGTGCCTGTCATC
TACCACGACTTCCTGGTCAGCGAGACAGGTATAGATGCGCCTGTTCATACCATGACACTTGATCAATTCCTCGAG
TTAGGCATCGGACGTTACCGTCATTCATTGCCGGGATCTGTCAAAACTAACGGCGAGGAATCTGAGCTTGGCCCG
CGCCAGCGCTCAATGTCGGTCGGTGGCTCCGAGTACAACCCGGCCGAATTGACCGAAAAGATCAAGCACACACGC
GACTTCAAGAAGAAGGGATTCAAGGGCAACACCCGCGGCGAGCACATTCAGGCACCATTCGCCACACTGGAGGAA
TTATTCAGGAAGATCCCGAAACCTGTCGGATTTAATATTGAACTAAAATACCCCATGCTCCACGAGAGCGAGGAG
GAAGAAATGGACACATACGCAGTGGAACTGAACTCCTTCGTCGACACCATCTTGACCAAGGTGTATGACCTAGGA
GGCGGCCGCGACATACTGTTCTCCAGCTTCAACCCGGACATCTGTCTGCTGCTCTCTTTCAAGCAGCCTTCCATC
CCCGTTCTTTTCTTGACTGACGCAGGCGCCTCCCCGGTCGGTGACATCCGTGCCAGCAGCTTGCAGGAGGCTATT
CGGTTCGCCTCACGGTGGAATCTCCTTGGAATCGTCACCCAGGCTGAACCACTGGTCCTCTGCCCACGACTAGTC
CGAATTGTCAAAGAGTCCGGTCTTGTGTGTGTCTCTTACGGAACACTCAACAATGAGGGCAAGAACGTCGACTAC
CAAGTCTCTGAAGGAATCGACGCCGTCATTGTCGACTCTGTGCTCGGCATCACCAACGGTCTCATCCAGCGCCAT
GGCAAGGGCGAACGCACACCAGGCACATCGCCTAATCCTTCGGCCGTCAAGGACCAGATCACTAACTCTGCCAAG
GGCGATGTCATAGTCCCGGCTCTTGAGCGGGTGAAACAAACTACCCTCTCACCGGATATGAATCCCCCTACCCTT
CTTTAA
Transcript >Pro_DTO377G3_2|g188.t1
ATGAAATTCGGCCGCAATTTGCCGCAGTTCACGGTTCCCGAGTGGAGCGGCTCTTACATCAAGTACAAGGCCCTG
AAGAAGCTGATCAAGTCTGCTGCTGAGCAGATCAAATCGGGACAGGAGCCGGATTTGGCTGGTTTCTTCTACAAC
CTCGACCGAAATGTTGAAGATGTCGATCATTTCTACAACAAGAAATATTCCGACTTCGCCCGCCGTCTGAAGTTG
CTCGAGGAGCGCTATGGCTACTCAATGGATGGTCGCCATGCTCTCGAGCCCGAGGATCGGCATGACCTGCGCGAG
GCCCTGCTGGACCTGCGATACCACTTGCGCCGCTTACAATGGTATGGTGAAGTCAATCGACGTGGCTTCGTCAAG
ATCACCAAGAAGTTGGACAAGAAGGTTGGTGCGCAGGCCCAGAAGCGCTATCTGGAGACGAAGGTCGATCCCGCC
CCGTTCGCCTCCAATGAGCGCGTCTTCCAGTCTCAGGATCGCATCAATGCTTGGATGGCCATCATTACGGACCAG
TCCAAGGCGGACGACAAGGCATCCGATGACACGAGCTCCACCCATTCTTCCCTTTCATTGAAGCGTGGCCCAACT
AGGCCTTATCTTAATCTGCCTACGAGCATTCTCACTGCTGTGGATGATGCCCTGCGCAAGGATGACACTCATGTC
TTCCTTGAACTACTCGAGACTTTGAAGGCCACTGCAGATGAAGCGGGAGACACGGTTTATCCTAGGGTTCTCAGA
ACCCTGATCCAGCGCTCTATCCTTCATCGTTCTCGTGCTGTCCTGAATCTTCTCCTGAACCGGGTGGACACCCTA
GAAGAGGACGATGACATCAACAGACGTAACTGCCTTCACCGTCTGGTCATTTCCATTGGTCGTGACCAGCCTACG
ACTGACGCCGAGCCCGCGGCGTCAATGGTGCTCAACTTCCCTCCGGAGACTACCCGCTATATCACACCCGCGGCA
CCTCCGACCCTCCAACCGCCGCGCCCCGTGGTCAAAGAGGAGCACATGCCCCAGCAGCTGGGTCGCGAGGATTCT
GCTGTTATTCACTTCCAATTTCTCTTAGACTCGCTGCGCCCTGATCAGCGTGAGTCTTTGATGGCCAAAGACCTT
GCTGGACGCACTCCATTGCACTATGCGGCACAGTATGGTTTCAAGGTCGTTTGTGAAGTGATCATTGAGCATCTC
AAAGAATGGGACATGTTCGATGTCAGCGATGGGATCGACGGTCCTCTCTGGCAGGACAATGACGGCTGGGCCCCG
CTTCATTTGAGTGTTGTGGGTGGCCACCCCAAAACCACCCGGTGTCTCTTGGATGCCGAAAAACAGCATGGTCCC
TCGCAGGGGCGGAGCATCATAAGAAAACAGGTCTCGAAGTCTAGTGCAGTATTGGTATTAGCGACCAAGGCCAAC
TTCATTGACATTGTCCAGCTTCTGGTGGATGCTGGTGTCGATATCAATTACCAGGATGAACAGGGAGAAACTGCA
TTGCACGTTGCCGCCCGATTTGGCCGTGACGAGTGCGCCCAAATTCTGCTGGATGGTAGCGACGACCAGAAGGCA
GACACAGAACTAGCTGAAAACACATATAGTTGGACTCCGCTCTTCATTGCCTGTGTGGACGGATCTCTGAGTGTG
GCCAAAATGCTGGTTTCCGCTGGTGCAGATGTGGAGCGTTTCGACTCCTCTGGCTGGACGGCTAAGGAGCACGCG
GCCCTCAGAGGCCATCTTGACATCGCCCGATGCTTGGCAGAAGTTAGCCCTGGCCCTCCTGCCACTGAGCCTGAT
TTTTCATCGTCTACTCCAAACCTCACTGGTTCCGATTCCTCCTCGCCCCCGACTCAGTCGTCCCTCACTGATCGC
CGGTCAAATGCGCCTGGCCCAACTTCTGGAGGTCCTGGCGTACGGTCCACTGAACCTATCAAGACTTTTGGACAC
AGGTATCTCACCGATGAGAGCATGATCTTGGTCAGTCTGGGAACTATGGACATGCGCAAGCCGCTTGAGACAGTC
AGCCTCGACCGCATTCCGATGGAGAATGCACATGCCACCCAGCTAGATACGTCTTTGTCGATGGTGATAACAGCT
AGCGGTGCACATGGTGAGCCGGAGGTGATTGACTTGCCTGTGCAGGACAATATCTCAACCGAGCCAATTGTCTTC
CACACTACCGATCCTAGCAAGGTGCGTCTGCTTTTCGACCTCATCCCCACCTACGCAGGATCGAAGGATAAGATT
GTTGGCCGGGGTGTCGCTCTGCTTTCTAGCATCAAGCCCACTGTCGGGTCGCACCGAATCAACCTCAAAGGTGAT
TCCACTGTTCCCATTGTTGCCGCGAATACCCTTGAGGTGATCGGGTCTGTGACGTTCAACTTCCTTATCATCACG
CCCTTCAAGCACCCGAAAATGTCTATCGCGGGCAACCAGACCTACTGGCGCTCGATGAGCTCCACCATGGTCATT
GGACACCGTGGACTAGGTAAGAATATGGCTGGCCGCAATTCGTTACAGTTGGGCGAGAATACTGTGGAGTCGTTC
ATCGCTGCAGCCAACCTGGGCGCCTCATATGTCGAGTTCGATGTACAGCTCACGAAAGACCATGTGCCTGTCATC
TACCACGACTTCCTGGTCAGCGAGACAGGTATAGATGCGCCTGTTCATACCATGACACTTGATCAATTCCTCGAG
TTAGGCATCGGACGTTACCGTCATTCATTGCCGGGATCTGTCAAAACTAACGGCGAGGAATCTGAGCTTGGCCCG
CGCCAGCGCTCAATGTCGGTCGGTGGCTCCGAGTACAACCCGGCCGAATTGACCGAAAAGATCAAGCACACACGC
GACTTCAAGAAGAAGGGATTCAAGGGCAACACCCGCGGCGAGCACATTCAGGCACCATTCGCCACACTGGAGGAA
TTATTCAGGAAGATCCCGAAACCTGTCGGATTTAATATTGAACTAAAATACCCCATGCTCCACGAGAGCGAGGAG
GAAGAAATGGACACATACGCAGTGGAACTGAACTCCTTCGTCGACACCATCTTGACCAAGGTGTATGACCTAGGA
GGCGGCCGCGACATACTGTTCTCCAGCTTCAACCCGGACATCTGTCTGCTGCTCTCTTTCAAGCAGCCTTCCATC
CCCGTTCTTTTCTTGACTGACGCAGGCGCCTCCCCGGTCGGTGACATCCGTGCCAGCAGCTTGCAGGAGGCTATT
CGGTTCGCCTCACGGTGGAATCTCCTTGGAATCGTCACCCAGGCTGAACCACTGGTCCTCTGCCCACGACTAGTC
CGAATTGTCAAAGAGTCCGGTCTTGTGTGTGTCTCTTACGGAACACTCAACAATGAGGGCAAGAACGTCGACTAC
CAAGTCTCTGAAGGAATCGACGCCGTCATTGTCGACTCTGTGCTCGGCATCACCAACGGTCTCATCCAGCGCCAT
GGCAAGGGCGAACGCACACCAGGCACATCGCCTAATCCTTCGGCCGTCAAGGACCAGATCACTAACTCTGCCAAG
GGCGATGTCATAGTCCCGGCTCTTGAGCGGGTGAAACAAACTACCCTCTCACCGGATATGAATCCCCCTACCCTT
CTTTAA
Gene >Pro_DTO377G3_2|g188.t1
ATGAAATTCGGCCGCAATTTGCCGCAGTTCACGGTTCCCGAGTGGAGCGGCTCTTACATCAAGTACAAGGCCCTG
AAGAAGCTGATCAAGTCTGCTGCTGAGCAGATCAAATCGGGACAGGAGCCGGATTTGGCTGGTAAGTTTAATGCT
TCATTTCCTTGAATTTATTATCTTGAACATTTGAGCGCTGTTCTGACCAGGCCGTTTGTGTTGCTGCCTATAGGT
TTCTTCTACAACCTCGACCGAAATGTTGAAGATGTCGATCATTTCTACAACAAGAAATATTCCGACTTCGCCCGC
CGTCTGAAGTTGCTCGAGGAGCGCTATGGCTACTCAATGGATGGTCGCCATGCTCTCGAGCCCGAGGATCGGCAT
GACCTGCGCGAGGCCCTGCTGGACCTGCGATACCACTTGCGCCGCTTACAATGGTATGGTGAAGTCAATCGACGT
GGCTTCGTCAAGATCACCAAGAAGTTGGACAAGAAGGTTGGTGCGCAGGCCCAGAAGCGCTATCTGGAGACGAAG
GTCGATCCCGCCCCGTTCGCCTCCAATGAGCGCGTCTTCCAGTCTCAGGATCGCATCAATGCTTGGATGGCCATC
ATTACGGACCAGTCCAAGGCGGACGACAAGGCATCCGATGACACGAGCTCCACCCATTCTTCCCTTTCATTGAAG
CGTGGCCCAACTAGGCCTTATCTTAATCTGCCTACGAGCATTCTCACTGCTGTGGATGATGCCCTGCGCAAGGAT
GACACTCATGTCTTCCTTGAACTACTCGAGACTTTGAAGGCCACTGCAGATGAAGCGGGAGACACGGTTTATCCT
AGGGTTCTCAGAACCCTGATCCAGCGCTCTATCCTTCATCGTTCTCGTGCTGTCCTGAATCTTCTCCTGAACCGG
GTGGACACCCTAGAAGAGGACGATGACATCAACAGACGTAACTGCCTTCACCGTCTGGTCATTTCCATTGGTCGT
GACCAGCCTACGACTGACGCCGAGCCCGCGGCGTCAATGGTGCTCAACTTCCCTCCGGAGACTACCCGCTATATC
ACACCCGCGGCACCTCCGACCCTCCAACCGCCGCGCCCCGTGGTCAAAGAGGAGCACATGCCCCAGCAGCTGGGT
CGCGAGGATTCTGCTGTTATTCACTTCCAATTTCTCTTAGACTCGCTGCGCCCTGATCAGCGTGAGTCTTTGATG
GCCAAAGACCTTGCTGGACGCACTCCATTGCACTATGCGGCACAGTATGGTTTCAAGGTCGTTTGTGAAGTGATC
ATTGAGCATCTCAAAGAATGGGACATGTTCGATGTCAGCGATGGGATCGACGGTCCTCTCTGGCAGGACAATGAC
GGCTGGGCCCCGCTTCATTTGAGTGTTGTGGGTGGCCACCCCAAAACCACCCGGTGTCTCTTGGATGCCGAAAAA
CAGCATGGTCCCTCGCAGGGGCGGAGCATCATAAGAAAACAGGTCTCGAAGTCTAGTGCAGTATTGGTATTAGCG
ACCAAGGCCAACTTCATTGACATTGTCCAGCTTCTGGTGGATGCTGGTGTCGATATCAATTACCAGGATGAACAG
GGAGAAACTGCATTGCACGTTGCCGCCCGATTTGGCCGTGACGAGTGCGCCCAAATTCTGCTGGATGGTAGCGAC
GACCAGAAGGCAGACACAGAACTAGCTGAAAACACATATAGTTGGACTCCGCTCTTCATTGCCTGTGTGGACGGA
TCTCTGAGTGTGGCCAAAATGCTGGTTTCCGCTGGTGCAGATGTGGAGCGTTTCGACTCCTCTGGCTGGACGGCT
AAGGAGCACGCGGCCCTCAGAGGCCATCTTGACATCGCCCGATGCTTGGCAGAAGTTAGCCCTGGCCCTCCTGCC
ACTGAGCCTGATTTTTCATCGTCTACTCCAAACCTCACTGGTTCCGATTCCTCCTCGCCCCCGACTCAGTCGTCC
CTCACTGATCGCCGGTCAAATGCGCCTGGCCCAACTTCTGGAGGTCCTGGCGTACGGTCCACTGAACCTATCAAG
ACTTTTGGACACAGGTATCTCACCGATGAGAGCATGATCTTGGTCAGTCTGGGAACTATGGACATGCGCAAGCCG
CTTGAGACAGTCAGCCTCGACCGCATTCCGATGGAGAATGCACATGCCACCCAGCTAGATACGTCTTTGTCGATG
GTGATAACAGCTAGCGGTGCACATGGTGAGCCGGAGGTGATTGACTTGCCTGTGCAGGACAATATCTCAACCGAG
CCAATTGTCTTCCACACTACCGATCCTAGCAAGGTGCGTCTGCTTTTCGACCTCATCCCCACCTACGCAGGATCG
AAGGATAAGATTGTTGGCCGGGGTGTCGCTCTGCTTTCTAGCATCAAGCCCACTGTCGGGTCGCACCGAATCAAC
CTCAAAGGTGATTCCACTGTTCCCATTGTTGCCGCGAATACCCTTGAGGTGATCGGGTCTGTGACGTTCAACTTC
CTTATCATCACGCCCTTCAAGCACCCGAAAATGTCTATCGCGGGCAACCAGACCTACTGGCGCTCGATGAGCTCC
ACCATGGTCATTGGACACCGTGGACTAGGTAAGAATATGGCTGGCCGCAATTCGTTACAGTTGGGCGAGAATACT
GTGGAGTCGTTCATCGCTGCAGCCAACCTGGGCGCCTCATATGTCGAGTTCGATGTACAGCTCACGAAAGACCAT
GTGCCTGTCATCTACCACGACTTCCTGGTCAGCGAGACAGGTATAGATGCGCCTGTTCATACCATGACACTTGAT
CAATTCCTCGAGTTAGGCATCGGACGTTACCGTCATTCATTGCCGGGATCTGTCAAAACTAACGGCGAGGAATCT
GAGCTTGGCCCGCGCCAGCGCTCAATGTCGGTCGGTGGCTCCGAGTACAACCCGGCCGAATTGACCGAAAAGATC
AAGCACACACGCGACTTCAAGAAGAAGGGATTCAAGGGCAACACCCGCGGCGAGCACATTCAGGCACCATTCGCC
ACACTGGAGGAATTATTCAGGAAGATCCCGAAACCTGTCGGATTTAATATTGAACTAAGTGAGTTACTAAAGCTT
CCCAAGAACAGCTATTCCGTCGATCTAACCAAGGTCGTCAGAATACCCCATGCTCCACGAGAGCGAGGAGGAAGA
AATGGACACATACGCAGTGGAACTGAACTCCTTCGTCGACACCATCTTGACCAAGGTGTATGACCTAGGAGGCGG
CCGCGACATACTGTTCTCCAGCTTCAACCCGGACATCTGTCTGCTGCTCTCTTTCAAGCAGCCTTCCATCCCCGT
TCTTTTCTTGACTGACGCAGGCGCCTCCCCGGTCGGTGACATCCGTGCCAGCAGCTTGCAGGAGGCTATTCGGTT
CGCCTCACGGTGGAATCTCCTTGGAATCGTCACCCAGGCTGAACCACTGGTCCTCTGCCCACGACTAGTCCGAAT
TGTCAAAGAGTCCGGTCTTGTGTGTGTCTCTTACGGAACACTCAACAATGAGGGCAAGAACGTCGACGTAAGTTA
TGGTCTTTTCACATCCCTAGAAATCTCAAACAACCGTCTTACCACATAATCCCTACAGTACCAAGTCTCTGAAGG
AATCGACGCCGTCATTGTCGACTCTGTGCTCGGCATCACCAACGGTCTCATCCAGCGCCATGGCAAGGGCGAACG
CACACCAGGCACATCGCCTAATCCTTCGGCCGTCAAGGACCAGATCACTAACTCTGCCAAGGGCGATGTCATAGT
CCCGGCTCTTGAGCGGGTGAAACAAACTACCCTCTCACCGGATATGAATCCCCCTACCCTTCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail