Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1855.t1
Gene name
Locationscaffold_02:997260..998764
Strand+
Gene length (bp)1504
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03198 Glyco_hydro_72 Glucanosyltransferase 4.9E-99 21 300

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 105.78 64.08 147.48
5d_25C Five days - 25 degrees Celsius 54.80 30.58 79.02
7d_25C Seven days - 25 degrees Celsius 47.12 26.12 68.12
10d_25C Ten days - 25 degrees Celsius 21.46 10.16 32.76
7d_15C Seven days - 15 degrees Celsius 50.72 26.50 74.95
7d_30C Seven days - 30 degrees Celsius 44.57 24.47 64.68

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.621873 no
5d_25C 7d_15C 0.827539 no
5d_25C 7d_30C 0.466142 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.842299 no
7d_25C 7d_30C 0.880353 no
7d_25C 10d_25C 0.001278 yes
7d_15C 7d_30C 0.689289 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.003197 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1855.t1
MLSSLAFSVPLLLAGLQATTVGAISPISAVGSKFFYENGTQFYIKGIAYQLTPSDPLVDTAQCKRDIVRMAELGT
NAIRVYHVDASADHKGCMSALADAGIHLFVDLDTFTTQIEQTAPHWNETQFDHFKAVLDEFQQFDNTAGVLVGNE
VLTTADGSAAAPYVLAAARDVKAYRDKKGYREIPVGYSAADIADLRPMLQNYMACSKNASERLDFYSLNAYEWCG
SSSYEQSGYNMLQKNATDYPIPIFFSETGCNTPSPRTFEDQAAIFGDKMSDTWSGSIIYEWIEETNDYGLISYGA
SVDPATATASNIEDGFTRQGTPTPVSPDFNNLKSQWATLNPSGVALSAYKKSASSAAIECPASTSGGWAVDPSSP
LPTLGQTYKKGSSSESTATGKTTKASATTSSGTSSASATKEGAAHSVTVGSPATERLLAGSLVLSGLLGAVAFWL
*
Coding >Pro_DTO377G3_2|g1855.t1
ATGTTGTCCTCCCTGGCATTTTCCGTGCCATTGCTCCTCGCGGGCCTCCAGGCCACCACCGTCGGCGCCATCTCC
CCCATTTCGGCGGTCGGCTCCAAGTTCTTCTACGAGAACGGAACCCAGTTCTACATCAAGGGCATTGCTTATCAG
CTTACCCCAAGTGACCCGCTTGTCGATACTGCCCAATGCAAGCGCGATATCGTCCGGATGGCCGAGCTGGGCACC
AATGCTATCCGTGTGTACCACGTGGATGCCAGCGCTGATCACAAAGGCTGTATGTCGGCATTGGCCGATGCTGGA
ATCCACTTGTTCGTCGACTTGGACACCTTTACTACCCAGATTGAACAGACCGCACCTCACTGGAACGAAACCCAG
TTTGATCACTTCAAGGCCGTGCTCGATGAGTTCCAACAGTTCGACAACACCGCCGGTGTCTTGGTCGGAAATGAG
GTCCTCACGACGGCCGATGGTTCGGCGGCTGCGCCCTACGTCTTGGCAGCTGCTCGCGACGTTAAGGCCTACCGT
GATAAGAAGGGCTATCGCGAGATTCCTGTTGGTTACTCCGCGGCCGATATTGCCGATCTGCGACCCATGCTGCAG
AACTACATGGCCTGTTCTAAGAATGCGTCCGAGCGCTTGGACTTTTACTCGCTGAACGCCTATGAGTGGTGTGGC
TCGTCCAGCTATGAACAGTCTGGATACAATATGCTGCAGAAGAACGCCACCGATTACCCCATCCCTATCTTCTTC
TCCGAGACCGGCTGCAACACCCCCTCACCCCGCACCTTTGAGGATCAGGCTGCCATCTTCGGCGATAAGATGTCT
GACACTTGGTCCGGATCCATCATCTACGAGTGGATCGAGGAGACCAACGACTATGGCTTGATCAGCTATGGCGCT
TCTGTCGACCCGGCGACCGCAACCGCAAGCAACATCGAGGACGGCTTCACCCGCCAGGGAACCCCAACACCCGTG
TCGCCTGATTTCAACAACCTCAAGTCGCAGTGGGCGACTCTGAACCCGAGCGGTGTTGCCCTTTCCGCCTACAAA
AAGAGCGCCTCCAGCGCCGCCATCGAGTGCCCTGCCTCGACCTCGGGTGGATGGGCCGTTGACCCAAGCTCGCCG
CTTCCTACCTTGGGACAGACCTACAAGAAGGGATCTTCATCTGAATCCACAGCGACCGGTAAGACTACCAAGGCC
AGTGCGACCACTTCAAGCGGAACATCCTCGGCATCGGCAACAAAGGAAGGCGCTGCTCACTCTGTGACTGTCGGC
TCGCCAGCTACTGAGCGCCTGCTCGCTGGATCCTTGGTGCTGTCTGGTCTGCTGGGAGCCGTTGCTTTCTGGCTT
TGA
Transcript >Pro_DTO377G3_2|g1855.t1
ATGTTGTCCTCCCTGGCATTTTCCGTGCCATTGCTCCTCGCGGGCCTCCAGGCCACCACCGTCGGCGCCATCTCC
CCCATTTCGGCGGTCGGCTCCAAGTTCTTCTACGAGAACGGAACCCAGTTCTACATCAAGGGCATTGCTTATCAG
CTTACCCCAAGTGACCCGCTTGTCGATACTGCCCAATGCAAGCGCGATATCGTCCGGATGGCCGAGCTGGGCACC
AATGCTATCCGTGTGTACCACGTGGATGCCAGCGCTGATCACAAAGGCTGTATGTCGGCATTGGCCGATGCTGGA
ATCCACTTGTTCGTCGACTTGGACACCTTTACTACCCAGATTGAACAGACCGCACCTCACTGGAACGAAACCCAG
TTTGATCACTTCAAGGCCGTGCTCGATGAGTTCCAACAGTTCGACAACACCGCCGGTGTCTTGGTCGGAAATGAG
GTCCTCACGACGGCCGATGGTTCGGCGGCTGCGCCCTACGTCTTGGCAGCTGCTCGCGACGTTAAGGCCTACCGT
GATAAGAAGGGCTATCGCGAGATTCCTGTTGGTTACTCCGCGGCCGATATTGCCGATCTGCGACCCATGCTGCAG
AACTACATGGCCTGTTCTAAGAATGCGTCCGAGCGCTTGGACTTTTACTCGCTGAACGCCTATGAGTGGTGTGGC
TCGTCCAGCTATGAACAGTCTGGATACAATATGCTGCAGAAGAACGCCACCGATTACCCCATCCCTATCTTCTTC
TCCGAGACCGGCTGCAACACCCCCTCACCCCGCACCTTTGAGGATCAGGCTGCCATCTTCGGCGATAAGATGTCT
GACACTTGGTCCGGATCCATCATCTACGAGTGGATCGAGGAGACCAACGACTATGGCTTGATCAGCTATGGCGCT
TCTGTCGACCCGGCGACCGCAACCGCAAGCAACATCGAGGACGGCTTCACCCGCCAGGGAACCCCAACACCCGTG
TCGCCTGATTTCAACAACCTCAAGTCGCAGTGGGCGACTCTGAACCCGAGCGGTGTTGCCCTTTCCGCCTACAAA
AAGAGCGCCTCCAGCGCCGCCATCGAGTGCCCTGCCTCGACCTCGGGTGGATGGGCCGTTGACCCAAGCTCGCCG
CTTCCTACCTTGGGACAGACCTACAAGAAGGGATCTTCATCTGAATCCACAGCGACCGGTAAGACTACCAAGGCC
AGTGCGACCACTTCAAGCGGAACATCCTCGGCATCGGCAACAAAGGAAGGCGCTGCTCACTCTGTGACTGTCGGC
TCGCCAGCTACTGAGCGCCTGCTCGCTGGATCCTTGGTGCTGTCTGGTCTGCTGGGAGCCGTTGCTTTCTGGCTT
TGA
Gene >Pro_DTO377G3_2|g1855.t1
ATGTTGTCCTCCCTGGCATTTTCCGTGCCATTGCTCCTCGCGGGCCTCCAGGCCACCACCGTCGGCGCCATCTCC
CCCATTTCGGCGGTCGGCTCCAAGTTCTTCTACGAGAACGGAACCCAGTTCTACATCAAGGGTACCTGAGAACCC
TGCACTGTAGGTATCCTGTCTGACTGACTCAAACAGGCATTGCTTATCAGCTTACCCCAAGTGACCCGCTTGTCG
ATACTGCCCAATGCAAGCGCGATATCGTCCGGATGGCCGAGCTGGGCACCAATGCTATCCGTGTGTACCACGTGG
ATGCCAGCGCTGATCACAAAGGCTGTATGTCGGCATTGGCCGATGCTGGTAGGTCGAGTCCACATGAGCAATCCC
CGGTAAATCATACTGATGCGTTGTAGGAATCCACTTGTTCGTCGACTTGGACACCTTTACTACCCAGATTGAACA
GGTAACTCCACTTCTCTTTCTCTTATGGACCATCTGTTAACGATCGCAGACCGCACCTCACTGGAACGAAACCCA
GTTTGATCACTTCAAGGCCGTGCTCGATGAGTTCCAACAGTTCGACAACACCGCCGGTGTCTTGGTCGGAAATGA
GGTCCTCACGACGGCCGATGGTTCGGCGGCTGCGCCCTACGTCTTGGCAGCTGCTCGCGACGTTAAGGCCTACCG
TGATAAGAAGGGCTATCGCGAGATTCCTGTTGGTTACTCCGCGGCCGATATTGCCGATCTGCGACCCATGCTGCA
GAACTACATGGCCTGTTCTAAGAATGCGTCCGAGCGCTTGGACTTTTACTCGCTGAACGCCTATGAGTGGTGTGG
CTCGTCCAGCTATGAACAGTCTGGATACAATATGCTGCAGAAGAACGCCACCGATTACCCCATCCCTATCTTCTT
CTCCGAGACCGGCTGCAACACCCCCTCACCCCGCACCTTTGAGGATCAGGCTGCCATCTTCGGCGATAAGATGTC
TGACACTTGGTCCGGATCCATCATCTACGAGTGGATCGAGGAGACCAACGACTATGGCTTGATCAGCTATGGCGC
TTCTGTCGACCCGGCGACCGCAACCGCAAGCAACATCGAGGACGGCTTCACCCGCCAGGGAACCCCAACACCCGT
GTCGCCTGATTTCAACAACCTCAAGTCGCAGTGGGCGACTCTGAACCCGAGCGGTGTTGCCCTTTCCGCCTACAA
AAAGAGCGCCTCCAGCGCCGCCATCGAGTGCCCTGCCTCGACCTCGGGTGGATGGGCCGTTGACCCAAGCTCGCC
GCTTCCTACCTTGGGACAGACCTACAAGAAGGGATCTTCATCTGAATCCACAGCGACCGGTAAGACTACCAAGGC
CAGTGCGACCACTTCAAGCGGAACATCCTCGGCATCGGCAACAAAGGAAGGCGCTGCTCACTCTGTGACTGTCGG
CTCGCCAGCTACTGAGCGCCTGCTCGCTGGATCCTTGGTGCTGTCTGGTCTGCTGGGAGCCGTTGCTTTCTGGCT
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail