Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1845.t1
Gene name
Locationscaffold_02:969896..970622
Strand+
Gene length (bp)726
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06859 Bin3 Bicoid-interacting protein 3 (Bin3) 1.4E-32 127 229
PF13489 Methyltransf_23 Methyltransferase domain 8.2E-12 35 170
PF13847 Methyltransf_31 Methyltransferase domain 2.3E-11 58 184
PF13649 Methyltransf_25 Methyltransferase domain 3.5E-09 61 163
PF08241 Methyltransf_11 Methyltransferase domain 3.2E-08 63 167

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1845.t1
MAEACHPPPATELSKAERFKATHLAARHGNYHQYYAKFRAPTVPDERLSILPSDILRDARVIDLGCNAGKLTYEA
IAHCGAAAAVGVDIDPWLVEQAKAAYPDGPCTFEHFDFVDASAYTGTALGKFDVVLLLSVTKWVHLNNGDSGMLT
LFAHIQSILNEGGYLVVEPQPMSNYARASKKNKELRETYKTIQIRPPFETELKALGFERILEVERDEEGFARPVH
VWKKKYHNTINGDGLK*
Coding >Pro_DTO377G3_2|g1845.t1
ATGGCAGAAGCATGCCATCCCCCGCCTGCAACAGAACTCTCTAAAGCAGAGCGCTTCAAAGCTACGCACCTCGCC
GCGCGCCATGGCAACTACCACCAATATTACGCCAAGTTTCGGGCACCTACCGTTCCAGACGAGCGCCTTTCTATT
CTCCCATCAGATATCCTCCGCGACGCGCGAGTCATAGACCTAGGCTGCAACGCGGGCAAACTGACCTATGAGGCG
ATAGCGCACTGCGGCGCGGCCGCCGCAGTCGGCGTCGATATCGACCCGTGGCTGGTCGAGCAGGCGAAGGCGGCG
TACCCGGACGGGCCGTGCACATTCGAGCACTTTGACTTCGTGGATGCGTCCGCGTACACGGGTACCGCGCTGGGC
AAGTTCGACGTTGTCCTACTGCTCTCTGTGACCAAGTGGGTTCATCTCAACAACGGGGACTCCGGGATGTTGACG
CTATTTGCGCACATACAAAGCATACTGAATGAGGGCGGCTATCTCGTCGTGGAGCCGCAGCCTATGAGCAATTAT
GCGAGAGCTTCAAAGAAGAATAAAGAATTGAGAGAGACGTATAAGACGATTCAGATCAGACCGCCGTTTGAGACT
GAGTTGAAAGCGCTGGGATTTGAGAGGATATTGGAAGTTGAGAGGGACGAGGAGGGGTTTGCCAGGCCCGTACAT
GTTTGGAAAAAAAAGTATCATAATACGATCAATGGAGATGGCTTAAAATGA
Transcript >Pro_DTO377G3_2|g1845.t1
ATGGCAGAAGCATGCCATCCCCCGCCTGCAACAGAACTCTCTAAAGCAGAGCGCTTCAAAGCTACGCACCTCGCC
GCGCGCCATGGCAACTACCACCAATATTACGCCAAGTTTCGGGCACCTACCGTTCCAGACGAGCGCCTTTCTATT
CTCCCATCAGATATCCTCCGCGACGCGCGAGTCATAGACCTAGGCTGCAACGCGGGCAAACTGACCTATGAGGCG
ATAGCGCACTGCGGCGCGGCCGCCGCAGTCGGCGTCGATATCGACCCGTGGCTGGTCGAGCAGGCGAAGGCGGCG
TACCCGGACGGGCCGTGCACATTCGAGCACTTTGACTTCGTGGATGCGTCCGCGTACACGGGTACCGCGCTGGGC
AAGTTCGACGTTGTCCTACTGCTCTCTGTGACCAAGTGGGTTCATCTCAACAACGGGGACTCCGGGATGTTGACG
CTATTTGCGCACATACAAAGCATACTGAATGAGGGCGGCTATCTCGTCGTGGAGCCGCAGCCTATGAGCAATTAT
GCGAGAGCTTCAAAGAAGAATAAAGAATTGAGAGAGACGTATAAGACGATTCAGATCAGACCGCCGTTTGAGACT
GAGTTGAAAGCGCTGGGATTTGAGAGGATATTGGAAGTTGAGAGGGACGAGGAGGGGTTTGCCAGGCCCGTACAT
GTTTGGAAAAAAAAGTATCATAATACGATCAATGGAGATGGCTTAAAATGA
Gene >Pro_DTO377G3_2|g1845.t1
ATGGCAGAAGCATGCCATCCCCCGCCTGCAACAGAACTCTCTAAAGCAGAGCGCTTCAAAGCTACGCACCTCGCC
GCGCGCCATGGCAACTACCACCAATATTACGCCAAGTTTCGGGCACCTACCGTTCCAGACGAGCGCCTTTCTATT
CTCCCATCAGATATCCTCCGCGACGCGCGAGTCATAGACCTAGGCTGCAACGCGGGCAAACTGACCTATGAGGCG
ATAGCGCACTGCGGCGCGGCCGCCGCAGTCGGCGTCGATATCGACCCGTGGCTGGTCGAGCAGGCGAAGGCGGCG
TACCCGGACGGGCCGTGCACATTCGAGCACTTTGACTTCGTGGATGCGTCCGCGTACACGGGTACCGCGCTGGGC
AAGTTCGACGTTGTCCTACTGCTCTCTGTGACCAAGTGGGTTCATCTCAACAACGGGGACTCCGGGATGTTGACG
CTATTTGCGCACATACAAAGCATACTGAATGAGGGCGGCTATCTCGTCGTGGAGCCGCAGCCTATGAGCAATTAT
GCGAGAGCTTCAAAGAAGAATAAAGAATTGAGAGAGACGTATAAGACGATTCAGATCAGACCGCCGTTTGAGACT
GAGTTGAAAGCGCTGGGATTTGAGAGGATATTGGAAGTTGAGAGGGACGAGGAGGGGTTTGCCAGGCCCGTACAT
GTTTGGAAAAAAAAGTATCATAATACGATCAATGGAGATGGCTTAAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail