Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1811.t1
Gene name
Locationscaffold_02:896178..898272
Strand-
Gene length (bp)2094
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08016 PKD_channel Polycystin cation channel 6.3E-05 265 462

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 231 253 22
2 268 287 19
3 294 316 22
4 345 367 22
5 374 396 22
6 434 456 22
7 490 512 22
8 522 541 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1811.t1
MGHWRNLFTADPGRTRHRIQVERRRLLPAYAADEPHASGASKELAKVALRLKYQIEQVVSCEVKDKFLTDPNSRI
ITDDVVATAMKAGGDEYKACVVYCLLVCLRWFKIQASVELWDSDLHEVRAVACEVIAKRIIESEPDQDYVLKDIL
LKRYSIFSEGVETDPANVIERSVDLHALKIISSAPYQRCILYLWRGWICQEEGNPTNFVEYSEKANTNYWVHFHP
DRMRTPLYQNVCQILFSLVYLAVYTAVINTVNPTGDVDVAEGILYGMTVAFICDEGLKFWKVGWNYLEFWNAFNS
TLYTILIVSLAMRFIALAHSTSANDEQRRLYNELSYNFLAFAGPMFWMRMMLYLDSVRFFGAMFVVLRVMMKESL
IFFALLFVVMAGFFQAFVGMAQVDDDYPLHRNILQGMVNSIMQSPEFDTFQEFAFPFGIILYYVFNFIVMTVLLN
ILIALYNSAYEDISGNATDEYMAIFAQKTMQFIRAPDENVFIPPFNLIEILFLIAPFEWWLSRNAYAKLNEFVMG
VIYSPLLIFAAWVETSRARQIQWNRRHGEADDEYAQEWEHVATDVNFDLDDTWKEQVMESMPDIKLDNCTYELRE
LKEQVRMLTGMVKELNREVMDKKADGAS*
Coding >Pro_DTO377G3_2|g1811.t1
ATGGGACATTGGAGGAATCTCTTTACCGCCGATCCTGGCAGGACGCGGCATCGCATCCAGGTGGAACGTCGTCGA
CTGCTACCTGCCTATGCTGCTGATGAGCCTCACGCCTCTGGTGCTTCAAAGGAACTTGCCAAGGTTGCTCTTCGG
TTGAAATATCAAATTGAGCAGGTTGTCTCATGCGAAGTGAAGGATAAATTCTTGACCGACCCAAATAGCCGCATC
ATCACGGACGATGTGGTTGCGACAGCCATGAAGGCTGGGGGAGATGAATACAAAGCATGCGTTGTTTATTGTCTT
TTAGTTTGTCTGCGATGGTTCAAGATTCAAGCCTCCGTCGAGCTCTGGGATTCCGATCTTCACGAGGTTCGGGCA
GTGGCTTGCGAGGTCATCGCCAAGCGCATAATCGAATCGGAGCCGGACCAAGATTACGTGCTGAAGGATATCTTG
CTCAAGCGGTACTCCATCTTCAGTGAAGGAGTAGAGACTGATCCCGCCAATGTCATTGAACGATCGGTAGATCTC
CACGCCTTGAAAATCATCAGCTCTGCCCCGTACCAGAGATGTATCCTGTACCTGTGGAGGGGTTGGATCTGTCAG
GAAGAGGGCAACCCAACTAACTTTGTCGAATACAGCGAGAAGGCTAACACTAACTATTGGGTTCATTTCCATCCT
GACCGGATGCGAACTCCTCTGTATCAGAATGTCTGCCAAATTTTGTTTTCCTTGGTTTACCTTGCGGTTTATACG
GCGGTCATCAATACCGTGAACCCAACCGGTGACGTGGACGTGGCCGAGGGCATTCTTTACGGTATGACTGTTGCG
TTCATCTGCGACGAAGGGCTCAAGTTTTGGAAGGTTGGATGGAATTACCTCGAATTCTGGAATGCCTTCAACTCA
ACCCTCTACACTATCCTGATCGTGTCACTTGCCATGCGGTTTATTGCCTTGGCACACTCAACATCTGCCAACGAT
GAACAAAGGCGGCTATACAACGAGCTCAGCTACAACTTCTTGGCATTTGCGGGCCCTATGTTCTGGATGCGCATG
ATGCTATACCTTGACTCGGTCCGCTTCTTCGGTGCTATGTTTGTGGTCCTCCGGGTCATGATGAAGGAGAGCTTG
ATATTCTTTGCTCTTCTATTTGTGGTGATGGCTGGTTTCTTCCAGGCCTTCGTCGGCATGGCCCAAGTAGATGAC
GACTATCCCCTTCACCGAAACATTCTCCAAGGAATGGTGAACAGTATCATGCAGAGTCCTGAGTTCGACACTTTC
CAGGAGTTTGCATTTCCCTTTGGCATCATCCTCTATTATGTTTTCAACTTCATTGTCATGACTGTTTTGTTGAAT
ATTCTCATTGCCTTGTACAACAGCGCATATGAAGATATCTCGGGCAATGCCACTGACGAATACATGGCCATCTTT
GCGCAGAAAACCATGCAGTTCATCCGCGCCCCAGATGAAAATGTCTTCATCCCGCCATTCAATCTCATTGAGATT
CTGTTTCTAATAGCCCCATTCGAATGGTGGCTTTCGCGGAACGCATACGCAAAGCTGAATGAATTTGTAATGGGT
GTGATCTATTCTCCTCTGCTTATCTTTGCGGCCTGGGTTGAGACCAGTCGGGCACGCCAGATTCAATGGAATCGA
CGCCATGGCGAAGCAGACGATGAATATGCCCAGGAATGGGAGCATGTGGCCACAGATGTCAACTTTGATCTTGAT
GATACTTGGAAAGAGCAGGTCATGGAGTCCATGCCGGATATCAAGCTTGATAATTGTACATATGAACTCAGGGAG
CTGAAAGAACAGGTTAGAATGTTGACGGGAATGGTGAAGGAGTTGAATCGGGAGGTGATGGACAAGAAGGCGGAT
GGAGCAAGCTAG
Transcript >Pro_DTO377G3_2|g1811.t1
ATGGGACATTGGAGGAATCTCTTTACCGCCGATCCTGGCAGGACGCGGCATCGCATCCAGGTGGAACGTCGTCGA
CTGCTACCTGCCTATGCTGCTGATGAGCCTCACGCCTCTGGTGCTTCAAAGGAACTTGCCAAGGTTGCTCTTCGG
TTGAAATATCAAATTGAGCAGGTTGTCTCATGCGAAGTGAAGGATAAATTCTTGACCGACCCAAATAGCCGCATC
ATCACGGACGATGTGGTTGCGACAGCCATGAAGGCTGGGGGAGATGAATACAAAGCATGCGTTGTTTATTGTCTT
TTAGTTTGTCTGCGATGGTTCAAGATTCAAGCCTCCGTCGAGCTCTGGGATTCCGATCTTCACGAGGTTCGGGCA
GTGGCTTGCGAGGTCATCGCCAAGCGCATAATCGAATCGGAGCCGGACCAAGATTACGTGCTGAAGGATATCTTG
CTCAAGCGGTACTCCATCTTCAGTGAAGGAGTAGAGACTGATCCCGCCAATGTCATTGAACGATCGGTAGATCTC
CACGCCTTGAAAATCATCAGCTCTGCCCCGTACCAGAGATGTATCCTGTACCTGTGGAGGGGTTGGATCTGTCAG
GAAGAGGGCAACCCAACTAACTTTGTCGAATACAGCGAGAAGGCTAACACTAACTATTGGGTTCATTTCCATCCT
GACCGGATGCGAACTCCTCTGTATCAGAATGTCTGCCAAATTTTGTTTTCCTTGGTTTACCTTGCGGTTTATACG
GCGGTCATCAATACCGTGAACCCAACCGGTGACGTGGACGTGGCCGAGGGCATTCTTTACGGTATGACTGTTGCG
TTCATCTGCGACGAAGGGCTCAAGTTTTGGAAGGTTGGATGGAATTACCTCGAATTCTGGAATGCCTTCAACTCA
ACCCTCTACACTATCCTGATCGTGTCACTTGCCATGCGGTTTATTGCCTTGGCACACTCAACATCTGCCAACGAT
GAACAAAGGCGGCTATACAACGAGCTCAGCTACAACTTCTTGGCATTTGCGGGCCCTATGTTCTGGATGCGCATG
ATGCTATACCTTGACTCGGTCCGCTTCTTCGGTGCTATGTTTGTGGTCCTCCGGGTCATGATGAAGGAGAGCTTG
ATATTCTTTGCTCTTCTATTTGTGGTGATGGCTGGTTTCTTCCAGGCCTTCGTCGGCATGGCCCAAGTAGATGAC
GACTATCCCCTTCACCGAAACATTCTCCAAGGAATGGTGAACAGTATCATGCAGAGTCCTGAGTTCGACACTTTC
CAGGAGTTTGCATTTCCCTTTGGCATCATCCTCTATTATGTTTTCAACTTCATTGTCATGACTGTTTTGTTGAAT
ATTCTCATTGCCTTGTACAACAGCGCATATGAAGATATCTCGGGCAATGCCACTGACGAATACATGGCCATCTTT
GCGCAGAAAACCATGCAGTTCATCCGCGCCCCAGATGAAAATGTCTTCATCCCGCCATTCAATCTCATTGAGATT
CTGTTTCTAATAGCCCCATTCGAATGGTGGCTTTCGCGGAACGCATACGCAAAGCTGAATGAATTTGTAATGGGT
GTGATCTATTCTCCTCTGCTTATCTTTGCGGCCTGGGTTGAGACCAGTCGGGCACGCCAGATTCAATGGAATCGA
CGCCATGGCGAAGCAGACGATGAATATGCCCAGGAATGGGAGCATGTGGCCACAGATGTCAACTTTGATCTTGAT
GATACTTGGAAAGAGCAGGTCATGGAGTCCATGCCGGATATCAAGCTTGATAATTGTACATATGAACTCAGGGAG
CTGAAAGAACAGGTTAGAATGTTGACGGGAATGGTGAAGGAGTTGAATCGGGAGGTGATGGACAAGAAGGCGGAT
GGAGCAAGCTAG
Gene >Pro_DTO377G3_2|g1811.t1
ATGGGACATTGGAGGAATCTCTTTACCGCCGATCCTGGCAGGACGCGGCATCGCATCCAGGTGGAACGTCGTCGA
CGTACGTCATTTCTAAACAATCGGCACCGCAATGTGCTAACAAGTCACAGTGCTACCTGCCTATGCTGCTGATGA
GCCTCACGCCTCTGGTGCTTCAAAGGAACTTGCCAAGGTTGCTCTTCGGTTGAAATATCAAATTGAGCAGGTTGT
CTCATGCGAAGTGAAGGATAAATTCTTGACCGACCCAAATAGCCGCATCATCACGGACGATGTGGTTGCGACAGC
CATGAAGGCTGGGGGAGATGAATACAAAGCATGCGTTGTTTATTGTCTTTTAGTTTGTCTGCGATGGTTCAAGAT
TCAAGCCTCCGTCGAGCTCTGGGATTCCGATCTTCACGAGGTTCGGGCAGTGGCTTGCGAGGTCATCGCCAAGCG
CATGTAATATCCCTTTGATATTTTGGGGTTTCTGCTATTTACTCACTACTTTGAACAGAATCGAATCGGAGCCGG
ACCAAGATTACGTGCTGAAGGATATCTTGCTCAAGCGGTACTCCATCTTCAGTGAAGGAGTAGAGACTGATCCCG
CCAATGTCATTGAACGATCGGTAGATCTCCACGCCTTGAAAATCATCAGCTCTGCCCCGTACCAGAGATGTATCC
TGTACCTGTGGAGGGGTTGGATCTGTCAGGAAGAGGGCAACCCAACTAACTTTGTCGAATACAGCGAGAAGGCTA
ACACTAACTATTGGGTTCATTTCCATCCTGACCGGATGCGAACTCCTCTGTATCAGAATGTCTGCCAAATTTTGT
TTTCCTTGGTTTACCTTGCGGTTTATACGGCGGTCATCAATACCGTGAACCCAACCGGTGACGTGGACGTGGCCG
AGGGCATTCTTTACGGTATGACTGTTGCGTTCATCTGCGACGAAGGGCTCAAGTTTTGGAAGGTTGGATGGAATT
ACCTCGAATTCTGGAATGCCTTCAACTCAACCCTCTACACTATCCTGATCGTGTCACTTGCCATGCGGTTTATTG
CCTTGGCACACTCAACATCTGCCAACGATGAACAAAGGCGGCTATACAACGAGCTCAGCTACAACTTCTTGGCAT
TTGCGGGCCCTATGTTCTGGATGCGCATGATGCTATACCTTGACTCGGTCCGCTTCTTCGGTGCTATGTTTGTGG
TCCTCCGGGTCATGATGAAGGAGAGCTTGATATTCTTTGCTCTTCTATTTGTGGTGATGGCTGGTTTCTTCCAGG
CCTTCGTCGGCATGGCCCAAGTAGATGACGACTATCCCCTTCACCGAAACATTCTCCAAGGAATGGTGAACAGTA
TCATGCAGAGTCCTGAGTTCGACACTTTCCAGGAGTTTGCATTTCCCTTTGGCATCATCCTCTATTATGTTTTCA
ACTTCATTGTCATGACTGGTAAGTTTGCGTCCAGCTTGTTTGGGCTTTTGTTGACAATTATCAGTTTTGTTGAAT
ATTCTCATTGCCTTGTACAACAGCGCATATGAAGATATCTCGGGCAATGCCACTGACGAATACATGGCCATCTTT
GCGCAGAAAACCATGCAGTTCATCCGCGCCCCAGATGAAAATGTCTTCATCCCGCGTACGTATTTTTTCCGCTTC
GATGGCACACGTGTGGCTAACTTAATCTGGATACTAGCATTCAATCTCATTGAGATTCTGTTTCTAATAGCCCCA
TTCGAATGGTGGCTTTCGCGGAACGCATACGCAAAGCTGAATGAATTTGTAATGGGTGTGATCTATTCTCCTCTG
CTTATCTTTGCGGCCTGGGTTGAGACCAGTCGGGCACGCCAGATTCAATGGAATCGACGCCATGGCGAAGCAGAC
GATGAATATGCCCAGGAATGGGAGCATGTGGCCACAGATGTCAACTTTGATCTTGATGATACTTGGAAAGAGCAG
GTCATGGAGTCCATGCCGGATATCAAGCTTGATAATTGTACATATGAACTCAGGGAGCTGAAAGAACAGGTTAGA
ATGTTGACGGGAATGGTGAAGGAGTTGAATCGGGAGGTGATGGACAAGAAGGCGGATGGAGCAAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail