Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1780.t1
Gene name
Locationscaffold_02:806322..808935
Strand-
Gene length (bp)2613
Transcript length (bp)2613
Coding sequence length (bp)2613
Protein length (aa) 871

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06738 ThrE Putative threonine/serine exporter 8.2E-68 422 666
PF06738 ThrE Putative threonine/serine exporter 3.1E-06 694 779
PF12821 ThrE_2 Threonine/Serine exporter, ThrE 4.7E-10 695 792

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 526 548 22
2 555 572 17
3 612 634 22
4 647 669 22
5 689 707 18
6 735 757 22
7 767 789 22
8 835 857 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1780.t1
MAGGYFDLPISRSASEEGSSSLSRSRSFTSSLLIDSFQGQPVSQVRSFSDASAQDKYRNAGILKNTNRVKLTDSE
SDLREQPTGPMVEFRLDQRGTELPQRPLPTANIPGFQEKVSSSSPLAPQVEDDHFSASAGVTGLTISTRTSSPGT
SAEYELGQGTNDKGRAICFAHERAHRLTSLLNCPHNCPKQSPQCSLVSEIGSTPTEVVCQTADEDKFPVISFPEK
QQLFDNLIDEHEAEFLDGRSTPCNSGAHYLVHQMSPRDLNFLTRLRPQSPGLHSSDQDTVSEDRNSYESAERTTS
YHGGILSSLLKLYEKPRYNHNQGRGRYGRSRQGSSSEFSGRGLSPDSVWKPQRKWYDKSTARSSISMAGSSRRSG
SPFAMLTRSRSSGAAVPNLSRSRPKAQLEDEIHITVHIAELLSRQRYLIQLCRALMKYGAPTHRLEEYMRMTARV
IQIDGQFLYIPGCMIISFDDASTHTTEVKVVRSSQGIDLGKLADVHEIYKEVIHDVIGVEEAIQRLDEVMKKQSK
FHIMFLIFAHGCASASVGPFAFNARPVDIPVAFLLGCLLGVLQLILSTKSSLYSNVFEISAAVLTSFLARAFGSI
RFNGEPLFCFSALAQSAIALILPGYTVLCASLELQSRSIVAGSVRMVYAIIYSLFLGFGITIGTAVYGLLDSQAS
TAYTCPASPIHNEYLQRFPFVILFTVCLAIVNRAKWKQMPIMIVISLAGYVTNYFSAKRFYSNTQVSNALGAFVI
GVMGNFYSRLQHGLAAAAMLPAIFVLVPSGLAASGSLISGITSAEEMTRSPYAVVNNGTQGFVDAAKKLSADEAR
SQSYGVVFDIGYGMVQVAIGTTVGLFLAALVVYPLGKKRSGLFSF*
Coding >Pro_DTO377G3_2|g1780.t1
ATGGCGGGAGGTTATTTTGACCTTCCGATCTCCCGCAGCGCCTCTGAGGAAGGATCGTCCAGTCTATCAAGGTCG
CGTTCCTTTACATCATCACTGCTCATTGATAGCTTCCAAGGCCAGCCAGTGTCTCAGGTGCGGAGCTTCAGTGAC
GCTAGCGCACAGGACAAGTATCGGAATGCCGGCATTCTGAAAAACACAAATCGCGTCAAGCTTACGGACAGCGAA
TCCGATTTGAGAGAACAACCCACTGGGCCTATGGTCGAATTCCGACTGGATCAAAGGGGCACCGAGCTGCCGCAA
AGACCATTACCCACTGCCAACATTCCGGGCTTTCAGGAGAAAGTATCCTCAAGCTCCCCACTGGCACCACAGGTG
GAAGACGATCATTTTAGCGCGTCAGCGGGTGTTACCGGTTTGACGATCAGCACCAGGACTAGCTCACCAGGAACT
TCAGCAGAGTATGAGCTTGGTCAGGGTACGAACGACAAGGGGCGGGCCATCTGCTTTGCACATGAAAGGGCCCAC
AGGCTCACATCCCTTCTCAATTGCCCGCATAATTGTCCGAAGCAAAGCCCCCAGTGCAGTCTAGTGTCTGAGATT
GGATCCACCCCCACCGAAGTGGTGTGCCAGACTGCAGATGAAGATAAATTTCCTGTGATAAGCTTCCCCGAGAAA
CAACAACTCTTCGACAACCTAATAGATGAACATGAAGCGGAATTCTTAGACGGGCGATCAACACCGTGCAACTCC
GGAGCACATTATCTAGTGCATCAAATGTCACCTCGAGACCTGAACTTTCTGACTCGCCTTCGCCCTCAGTCTCCC
GGGTTGCACTCCAGTGACCAAGACACCGTCAGCGAGGACAGGAACTCATACGAGTCTGCTGAACGGACGACAAGT
TATCACGGAGGAATTCTCTCATCGCTGCTCAAGCTCTACGAGAAGCCTCGTTATAACCACAACCAAGGTCGAGGA
CGGTATGGGCGGTCTCGACAGGGGAGCTCTTCCGAGTTCAGTGGACGTGGCCTGTCTCCAGACTCCGTTTGGAAA
CCGCAAAGGAAGTGGTACGATAAATCAACCGCTCGTTCTAGCATTTCCATGGCCGGCTCCTCCCGCCGCTCTGGC
TCCCCCTTTGCCATGCTCACGCGGTCCCGCAGCAGTGGTGCGGCCGTTCCAAACCTAAGCCGCTCACGTCCCAAG
GCTCAGCTTGAGGATGAAATTCATATCACTGTTCATATTGCCGAGCTTCTGTCTCGACAACGGTACTTGATCCAG
CTTTGTCGCGCTTTGATGAAGTATGGAGCTCCAACTCATCGATTGGAGGAATATATGCGCATGACAGCTCGCGTC
ATCCAAATAGATGGCCAGTTTTTGTACATACCCGGCTGCATGATCATCTCCTTTGACGACGCCTCCACACACACA
ACAGAGGTCAAAGTCGTCCGATCCAGTCAAGGCATTGACCTGGGTAAGCTGGCTGATGTGCATGAGATTTATAAG
GAAGTGATTCACGATGTTATTGGGGTTGAAGAGGCAATACAGCGGCTCGATGAGGTCATGAAGAAGCAGAGCAAA
TTCCACATTATGTTCCTCATCTTCGCCCACGGCTGTGCTAGCGCATCAGTCGGGCCCTTTGCCTTCAACGCCCGA
CCGGTGGATATCCCCGTGGCGTTTCTACTGGGATGTCTCCTCGGCGTGTTACAATTGATCCTGTCAACCAAATCG
AGCCTATATTCGAACGTGTTTGAGATCTCCGCCGCAGTCCTGACGTCTTTCCTTGCCCGTGCCTTTGGAAGCATC
AGGTTCAATGGGGAACCTCTGTTCTGCTTTTCTGCCCTCGCACAGTCGGCCATCGCCCTCATCCTGCCAGGATAC
ACTGTATTATGTGCTAGTCTGGAGCTCCAGTCACGCAGTATCGTTGCAGGTTCTGTTCGCATGGTCTATGCTATC
ATATACTCGCTGTTCCTCGGATTTGGAATTACCATCGGCACTGCCGTTTACGGGCTCCTCGACTCTCAAGCTTCA
ACGGCGTATACATGTCCCGCCAGCCCCATCCACAACGAGTACCTGCAACGGTTTCCGTTCGTCATCCTATTCACT
GTGTGCCTGGCGATCGTCAACCGCGCCAAGTGGAAGCAAATGCCGATTATGATAGTGATCTCCCTGGCTGGCTAC
GTGACCAACTACTTCAGCGCCAAGCGCTTCTATTCCAACACCCAGGTGTCCAATGCCCTGGGCGCCTTTGTCATT
GGTGTGATGGGCAATTTCTACAGCCGCTTACAGCATGGGCTCGCCGCTGCGGCAATGCTGCCGGCAATCTTTGTC
CTCGTTCCCTCCGGTCTTGCCGCTAGTGGGTCTCTGATATCTGGTATTACTTCTGCTGAGGAAATGACCCGGTCT
CCATATGCGGTTGTGAACAATGGGACACAAGGATTTGTCGACGCGGCAAAGAAGCTATCAGCCGACGAGGCGAGA
AGCCAAAGCTACGGGGTTGTTTTCGATATCGGATATGGCATGGTTCAAGTTGCTATTGGAACGACAGTTGGTCTC
TTCCTAGCCGCTTTGGTGGTTTATCCGCTAGGCAAGAAGCGAAGCGGATTGTTCAGTTTCTAG
Transcript >Pro_DTO377G3_2|g1780.t1
ATGGCGGGAGGTTATTTTGACCTTCCGATCTCCCGCAGCGCCTCTGAGGAAGGATCGTCCAGTCTATCAAGGTCG
CGTTCCTTTACATCATCACTGCTCATTGATAGCTTCCAAGGCCAGCCAGTGTCTCAGGTGCGGAGCTTCAGTGAC
GCTAGCGCACAGGACAAGTATCGGAATGCCGGCATTCTGAAAAACACAAATCGCGTCAAGCTTACGGACAGCGAA
TCCGATTTGAGAGAACAACCCACTGGGCCTATGGTCGAATTCCGACTGGATCAAAGGGGCACCGAGCTGCCGCAA
AGACCATTACCCACTGCCAACATTCCGGGCTTTCAGGAGAAAGTATCCTCAAGCTCCCCACTGGCACCACAGGTG
GAAGACGATCATTTTAGCGCGTCAGCGGGTGTTACCGGTTTGACGATCAGCACCAGGACTAGCTCACCAGGAACT
TCAGCAGAGTATGAGCTTGGTCAGGGTACGAACGACAAGGGGCGGGCCATCTGCTTTGCACATGAAAGGGCCCAC
AGGCTCACATCCCTTCTCAATTGCCCGCATAATTGTCCGAAGCAAAGCCCCCAGTGCAGTCTAGTGTCTGAGATT
GGATCCACCCCCACCGAAGTGGTGTGCCAGACTGCAGATGAAGATAAATTTCCTGTGATAAGCTTCCCCGAGAAA
CAACAACTCTTCGACAACCTAATAGATGAACATGAAGCGGAATTCTTAGACGGGCGATCAACACCGTGCAACTCC
GGAGCACATTATCTAGTGCATCAAATGTCACCTCGAGACCTGAACTTTCTGACTCGCCTTCGCCCTCAGTCTCCC
GGGTTGCACTCCAGTGACCAAGACACCGTCAGCGAGGACAGGAACTCATACGAGTCTGCTGAACGGACGACAAGT
TATCACGGAGGAATTCTCTCATCGCTGCTCAAGCTCTACGAGAAGCCTCGTTATAACCACAACCAAGGTCGAGGA
CGGTATGGGCGGTCTCGACAGGGGAGCTCTTCCGAGTTCAGTGGACGTGGCCTGTCTCCAGACTCCGTTTGGAAA
CCGCAAAGGAAGTGGTACGATAAATCAACCGCTCGTTCTAGCATTTCCATGGCCGGCTCCTCCCGCCGCTCTGGC
TCCCCCTTTGCCATGCTCACGCGGTCCCGCAGCAGTGGTGCGGCCGTTCCAAACCTAAGCCGCTCACGTCCCAAG
GCTCAGCTTGAGGATGAAATTCATATCACTGTTCATATTGCCGAGCTTCTGTCTCGACAACGGTACTTGATCCAG
CTTTGTCGCGCTTTGATGAAGTATGGAGCTCCAACTCATCGATTGGAGGAATATATGCGCATGACAGCTCGCGTC
ATCCAAATAGATGGCCAGTTTTTGTACATACCCGGCTGCATGATCATCTCCTTTGACGACGCCTCCACACACACA
ACAGAGGTCAAAGTCGTCCGATCCAGTCAAGGCATTGACCTGGGTAAGCTGGCTGATGTGCATGAGATTTATAAG
GAAGTGATTCACGATGTTATTGGGGTTGAAGAGGCAATACAGCGGCTCGATGAGGTCATGAAGAAGCAGAGCAAA
TTCCACATTATGTTCCTCATCTTCGCCCACGGCTGTGCTAGCGCATCAGTCGGGCCCTTTGCCTTCAACGCCCGA
CCGGTGGATATCCCCGTGGCGTTTCTACTGGGATGTCTCCTCGGCGTGTTACAATTGATCCTGTCAACCAAATCG
AGCCTATATTCGAACGTGTTTGAGATCTCCGCCGCAGTCCTGACGTCTTTCCTTGCCCGTGCCTTTGGAAGCATC
AGGTTCAATGGGGAACCTCTGTTCTGCTTTTCTGCCCTCGCACAGTCGGCCATCGCCCTCATCCTGCCAGGATAC
ACTGTATTATGTGCTAGTCTGGAGCTCCAGTCACGCAGTATCGTTGCAGGTTCTGTTCGCATGGTCTATGCTATC
ATATACTCGCTGTTCCTCGGATTTGGAATTACCATCGGCACTGCCGTTTACGGGCTCCTCGACTCTCAAGCTTCA
ACGGCGTATACATGTCCCGCCAGCCCCATCCACAACGAGTACCTGCAACGGTTTCCGTTCGTCATCCTATTCACT
GTGTGCCTGGCGATCGTCAACCGCGCCAAGTGGAAGCAAATGCCGATTATGATAGTGATCTCCCTGGCTGGCTAC
GTGACCAACTACTTCAGCGCCAAGCGCTTCTATTCCAACACCCAGGTGTCCAATGCCCTGGGCGCCTTTGTCATT
GGTGTGATGGGCAATTTCTACAGCCGCTTACAGCATGGGCTCGCCGCTGCGGCAATGCTGCCGGCAATCTTTGTC
CTCGTTCCCTCCGGTCTTGCCGCTAGTGGGTCTCTGATATCTGGTATTACTTCTGCTGAGGAAATGACCCGGTCT
CCATATGCGGTTGTGAACAATGGGACACAAGGATTTGTCGACGCGGCAAAGAAGCTATCAGCCGACGAGGCGAGA
AGCCAAAGCTACGGGGTTGTTTTCGATATCGGATATGGCATGGTTCAAGTTGCTATTGGAACGACAGTTGGTCTC
TTCCTAGCCGCTTTGGTGGTTTATCCGCTAGGCAAGAAGCGAAGCGGATTGTTCAGTTTCTAG
Gene >Pro_DTO377G3_2|g1780.t1
ATGGCGGGAGGTTATTTTGACCTTCCGATCTCCCGCAGCGCCTCTGAGGAAGGATCGTCCAGTCTATCAAGGTCG
CGTTCCTTTACATCATCACTGCTCATTGATAGCTTCCAAGGCCAGCCAGTGTCTCAGGTGCGGAGCTTCAGTGAC
GCTAGCGCACAGGACAAGTATCGGAATGCCGGCATTCTGAAAAACACAAATCGCGTCAAGCTTACGGACAGCGAA
TCCGATTTGAGAGAACAACCCACTGGGCCTATGGTCGAATTCCGACTGGATCAAAGGGGCACCGAGCTGCCGCAA
AGACCATTACCCACTGCCAACATTCCGGGCTTTCAGGAGAAAGTATCCTCAAGCTCCCCACTGGCACCACAGGTG
GAAGACGATCATTTTAGCGCGTCAGCGGGTGTTACCGGTTTGACGATCAGCACCAGGACTAGCTCACCAGGAACT
TCAGCAGAGTATGAGCTTGGTCAGGGTACGAACGACAAGGGGCGGGCCATCTGCTTTGCACATGAAAGGGCCCAC
AGGCTCACATCCCTTCTCAATTGCCCGCATAATTGTCCGAAGCAAAGCCCCCAGTGCAGTCTAGTGTCTGAGATT
GGATCCACCCCCACCGAAGTGGTGTGCCAGACTGCAGATGAAGATAAATTTCCTGTGATAAGCTTCCCCGAGAAA
CAACAACTCTTCGACAACCTAATAGATGAACATGAAGCGGAATTCTTAGACGGGCGATCAACACCGTGCAACTCC
GGAGCACATTATCTAGTGCATCAAATGTCACCTCGAGACCTGAACTTTCTGACTCGCCTTCGCCCTCAGTCTCCC
GGGTTGCACTCCAGTGACCAAGACACCGTCAGCGAGGACAGGAACTCATACGAGTCTGCTGAACGGACGACAAGT
TATCACGGAGGAATTCTCTCATCGCTGCTCAAGCTCTACGAGAAGCCTCGTTATAACCACAACCAAGGTCGAGGA
CGGTATGGGCGGTCTCGACAGGGGAGCTCTTCCGAGTTCAGTGGACGTGGCCTGTCTCCAGACTCCGTTTGGAAA
CCGCAAAGGAAGTGGTACGATAAATCAACCGCTCGTTCTAGCATTTCCATGGCCGGCTCCTCCCGCCGCTCTGGC
TCCCCCTTTGCCATGCTCACGCGGTCCCGCAGCAGTGGTGCGGCCGTTCCAAACCTAAGCCGCTCACGTCCCAAG
GCTCAGCTTGAGGATGAAATTCATATCACTGTTCATATTGCCGAGCTTCTGTCTCGACAACGGTACTTGATCCAG
CTTTGTCGCGCTTTGATGAAGTATGGAGCTCCAACTCATCGATTGGAGGAATATATGCGCATGACAGCTCGCGTC
ATCCAAATAGATGGCCAGTTTTTGTACATACCCGGCTGCATGATCATCTCCTTTGACGACGCCTCCACACACACA
ACAGAGGTCAAAGTCGTCCGATCCAGTCAAGGCATTGACCTGGGTAAGCTGGCTGATGTGCATGAGATTTATAAG
GAAGTGATTCACGATGTTATTGGGGTTGAAGAGGCAATACAGCGGCTCGATGAGGTCATGAAGAAGCAGAGCAAA
TTCCACATTATGTTCCTCATCTTCGCCCACGGCTGTGCTAGCGCATCAGTCGGGCCCTTTGCCTTCAACGCCCGA
CCGGTGGATATCCCCGTGGCGTTTCTACTGGGATGTCTCCTCGGCGTGTTACAATTGATCCTGTCAACCAAATCG
AGCCTATATTCGAACGTGTTTGAGATCTCCGCCGCAGTCCTGACGTCTTTCCTTGCCCGTGCCTTTGGAAGCATC
AGGTTCAATGGGGAACCTCTGTTCTGCTTTTCTGCCCTCGCACAGTCGGCCATCGCCCTCATCCTGCCAGGATAC
ACTGTATTATGTGCTAGTCTGGAGCTCCAGTCACGCAGTATCGTTGCAGGTTCTGTTCGCATGGTCTATGCTATC
ATATACTCGCTGTTCCTCGGATTTGGAATTACCATCGGCACTGCCGTTTACGGGCTCCTCGACTCTCAAGCTTCA
ACGGCGTATACATGTCCCGCCAGCCCCATCCACAACGAGTACCTGCAACGGTTTCCGTTCGTCATCCTATTCACT
GTGTGCCTGGCGATCGTCAACCGCGCCAAGTGGAAGCAAATGCCGATTATGATAGTGATCTCCCTGGCTGGCTAC
GTGACCAACTACTTCAGCGCCAAGCGCTTCTATTCCAACACCCAGGTGTCCAATGCCCTGGGCGCCTTTGTCATT
GGTGTGATGGGCAATTTCTACAGCCGCTTACAGCATGGGCTCGCCGCTGCGGCAATGCTGCCGGCAATCTTTGTC
CTCGTTCCCTCCGGTCTTGCCGCTAGTGGGTCTCTGATATCTGGTATTACTTCTGCTGAGGAAATGACCCGGTCT
CCATATGCGGTTGTGAACAATGGGACACAAGGATTTGTCGACGCGGCAAAGAAGCTATCAGCCGACGAGGCGAGA
AGCCAAAGCTACGGGGTTGTTTTCGATATCGGATATGGCATGGTTCAAGTTGCTATTGGAACGACAGTTGGTCTC
TTCCTAGCCGCTTTGGTGGTTTATCCGCTAGGCAAGAAGCGAAGCGGATTGTTCAGTTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail