Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g1765.t1
Gene name
Locationscaffold_02:770736..771708
Strand+
Gene length (bp)972
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02089 Palm_thioest Palmitoyl protein thioesterase 2.7E-89 34 289

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 111.44 67.80 155.07
5d_25C Five days - 25 degrees Celsius 110.29 66.86 153.72
7d_25C Seven days - 25 degrees Celsius 112.00 67.33 156.68
10d_25C Ten days - 25 degrees Celsius 148.93 91.12 206.74
7d_15C Seven days - 15 degrees Celsius 135.66 82.84 188.48
7d_30C Seven days - 30 degrees Celsius 117.90 71.51 164.28

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.977802 no
3d_25C 7d_25C 0.989804 no
3d_25C 7d_15C 0.428908 no
3d_25C 7d_30C 0.860706 no
3d_25C 10d_25C 0.190465 no
5d_25C 7d_25C 0.966105 no
5d_25C 7d_15C 0.406227 no
5d_25C 7d_30C 0.833843 no
5d_25C 10d_25C 0.173334 no
7d_25C 7d_15C 0.447943 no
7d_25C 7d_30C 0.877126 no
7d_25C 10d_25C 0.202897 no
7d_15C 7d_30C 0.606714 no
7d_15C 10d_25C 0.745252 no
7d_30C 10d_25C 0.312568 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g1765.t1
MRSITLLAALATNALSIALPWQSAPDTTSGTQLPLVIWHGLGDDFEREGLAEVANLAEATNPGTYVHLIRLANDG
SGDRSAAFFGNVTEQIALVCEQLATDPILSTAPAVNALGFSQGGQFLRGYIERCNTPPVHNLVTFGSQHNGISAF
ESCAYDNWFCKGAEQLLRSGRWTSFAQSRVVPAQYFRDPEDLDSYLEHSNFLADINNERAVKNETYKKNLAALNR
FAMFMFEDDTVAVPKESALFSEVNATTGEVTALRERPIYKEDWVGLKQLDEQGKLDFNTAPGEHMDLSEKTLRKA
FTQYFGPLEKSRPSPGLVVQPVF*
Coding >Pro_DTO377G3_2|g1765.t1
ATGCGTTCTATCACACTGTTGGCCGCACTGGCCACCAACGCACTCTCAATCGCGCTCCCGTGGCAATCCGCCCCA
GATACAACCAGCGGAACCCAACTCCCGCTCGTGATCTGGCACGGTCTAGGCGATGACTTCGAACGCGAAGGGCTG
GCCGAAGTTGCCAATCTAGCCGAAGCCACCAACCCCGGCACCTACGTGCACCTCATCCGCCTAGCCAACGACGGC
AGCGGCGACCGCTCCGCAGCCTTTTTCGGCAACGTAACAGAGCAAATCGCGCTAGTCTGCGAGCAGCTCGCCACA
GACCCAATCCTCAGCACAGCGCCCGCCGTCAACGCACTAGGCTTCTCACAGGGCGGCCAATTCCTCCGCGGGTAC
ATCGAGCGGTGCAACACGCCGCCCGTGCACAACCTCGTCACATTCGGCAGCCAGCACAACGGCATCTCGGCGTTC
GAGTCGTGCGCCTACGACAATTGGTTCTGCAAGGGCGCGGAGCAGCTCCTGCGGTCGGGACGGTGGACGAGCTTT
GCGCAGTCGCGCGTCGTGCCGGCGCAGTACTTCCGCGATCCGGAAGACCTGGATTCGTACCTCGAGCACAGCAAT
TTTCTGGCGGATATCAACAACGAGCGGGCGGTCAAGAACGAGACGTATAAGAAGAATCTGGCGGCGCTGAATCGG
TTTGCCATGTTTATGTTTGAGGATGATACGGTTGCTGTTCCGAAGGAGAGTGCTTTGTTCTCGGAGGTTAATGCT
ACTACTGGTGAGGTGACGGCTCTGCGCGAGAGGCCGATCTATAAGGAGGATTGGGTCGGGCTGAAGCAGCTGGAT
GAGCAGGGGAAGCTGGACTTCAATACTGCCCCTGGAGAGCATATGGATCTGTCTGAAAAGACGCTGCGCAAGGCT
TTCACTCAGTACTTTGGTCCGCTGGAGAAGTCGCGTCCTTCGCCGGGTCTAGTTGTGCAGCCCGTGTTCTGA
Transcript >Pro_DTO377G3_2|g1765.t1
ATGCGTTCTATCACACTGTTGGCCGCACTGGCCACCAACGCACTCTCAATCGCGCTCCCGTGGCAATCCGCCCCA
GATACAACCAGCGGAACCCAACTCCCGCTCGTGATCTGGCACGGTCTAGGCGATGACTTCGAACGCGAAGGGCTG
GCCGAAGTTGCCAATCTAGCCGAAGCCACCAACCCCGGCACCTACGTGCACCTCATCCGCCTAGCCAACGACGGC
AGCGGCGACCGCTCCGCAGCCTTTTTCGGCAACGTAACAGAGCAAATCGCGCTAGTCTGCGAGCAGCTCGCCACA
GACCCAATCCTCAGCACAGCGCCCGCCGTCAACGCACTAGGCTTCTCACAGGGCGGCCAATTCCTCCGCGGGTAC
ATCGAGCGGTGCAACACGCCGCCCGTGCACAACCTCGTCACATTCGGCAGCCAGCACAACGGCATCTCGGCGTTC
GAGTCGTGCGCCTACGACAATTGGTTCTGCAAGGGCGCGGAGCAGCTCCTGCGGTCGGGACGGTGGACGAGCTTT
GCGCAGTCGCGCGTCGTGCCGGCGCAGTACTTCCGCGATCCGGAAGACCTGGATTCGTACCTCGAGCACAGCAAT
TTTCTGGCGGATATCAACAACGAGCGGGCGGTCAAGAACGAGACGTATAAGAAGAATCTGGCGGCGCTGAATCGG
TTTGCCATGTTTATGTTTGAGGATGATACGGTTGCTGTTCCGAAGGAGAGTGCTTTGTTCTCGGAGGTTAATGCT
ACTACTGGTGAGGTGACGGCTCTGCGCGAGAGGCCGATCTATAAGGAGGATTGGGTCGGGCTGAAGCAGCTGGAT
GAGCAGGGGAAGCTGGACTTCAATACTGCCCCTGGAGAGCATATGGATCTGTCTGAAAAGACGCTGCGCAAGGCT
TTCACTCAGTACTTTGGTCCGCTGGAGAAGTCGCGTCCTTCGCCGGGTCTAGTTGTGCAGCCCGTGTTCTGA
Gene >Pro_DTO377G3_2|g1765.t1
ATGCGTTCTATCACACTGTTGGCCGCACTGGCCACCAACGCACTCTCAATCGCGCTCCCGTGGCAATCCGCCCCA
GATACAACCAGCGGAACCCAACTCCCGCTCGTGATCTGGCACGGTCTAGGCGATGACTTCGAACGCGAAGGGCTG
GCCGAAGTTGCCAATCTAGCCGAAGCCACCAACCCCGGCACCTACGTGCACCTCATCCGCCTAGCCAACGACGGC
AGCGGCGACCGCTCCGCAGCCTTTTTCGGCAACGTAACAGAGCAAATCGCGCTAGTCTGCGAGCAGCTCGCCACA
GACCCAATCCTCAGCACAGCGCCCGCCGTCAACGCACTAGGCTTCTCACAGGGCGGCCAATTCCTCCGCGGGTAC
ATCGAGCGGTGCAACACGCCGCCCGTGCACAACCTCGTCACATTCGGCAGCCAGCACAACGGCATCTCGGCGTTC
GAGTCGTGCGCCTACGACAATTGGTTCTGCAAGGGCGCGGAGCAGCTCCTGCGGTCGGGACGGTGGACGAGCTTT
GCGCAGTCGCGCGTCGTGCCGGCGCAGTACTTCCGCGATCCGGAAGACCTGGATTCGTACCTCGAGCACAGCAAT
TTTCTGGCGGATATCAACAACGAGCGGGCGGTCAAGAACGAGACGTATAAGAAGAATCTGGCGGCGCTGAATCGG
TTTGCCATGTTTATGTTTGAGGATGATACGGTTGCTGTTCCGAAGGAGAGTGCTTTGTTCTCGGAGGTTAATGCT
ACTACTGGTGAGGTGACGGCTCTGCGCGAGAGGCCGATCTATAAGGAGGATTGGGTCGGGCTGAAGCAGCTGGAT
GAGCAGGGGAAGCTGGACTTCAATACTGCCCCTGGAGAGCATATGGATCTGTCTGAAAAGACGCTGCGCAAGGCT
TTCACTCAGTACTTTGGTCCGCTGGAGAAGTCGCGTCCTTCGCCGGGTCTAGTTGTGCAGCCCGTGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail